Разное

Айди вк: Определение цифрового ID ВК для страницы или группы

09.07.2019

Содержание

Как узнать свой id вк. Как быстро узнать ID страницы в ВКонтакте. Как узнать свой ID ВКонтакте

Социальная сеть «ВКонтакте » дает каждому пользователю уникальный идентификатор или ID. Сразу после регистрации это стандартный набор символов, состоящий из первых букв «ID» и еще 9 случайных цифр. По желанию пользователя можно изменить АйДи пользователя или группы «ВКонтакте » на короткую ссылку. Чаще всего это транскрипция имени человека или названия группы, если эта комбинация свободна , например, Ульяна Лебедева — yla_lebedeva.

АйДи страницы не меняется при включении короткой ссылки. Внутри системы он остается неизменным, но становится скрытым от других пользователей.

Знание точного ID поможет найти любого человека, группу или сообщество, даже если текст короткой ссылки несколько раз менялся.

Способы определения ID в социальной сети «ВКонтакте»

Рассмотрим несколько вариантов, как узнать ID страницы «ВКонтакте ».

Адресная строка

Для начала нужно авторизоваться в

ВК , то есть ввести свой логин и пароль. Когда система опознает вас как пользователя, то сначала увидите свою ленту новостей, а адресная строка выглядит так: «https://vk.com/feed». Чтобы все-таки узнать свой ID, нажмите на пункт меню «».

Теперь адресная строка показывает именно то, что надо. Если за последним знаком «/» следует «ID» и еще 9 цифр — это и есть идентификатор.

Определить номера чужих страниц так же легко, как узнать свой ID «ВКонтакте », если стандартный номер не заменили на «красивый»:

  • ID группы или https://vk.com/club106559582
  • ID паблика ВК : https://vk.com/public109561031
  • ID чужой страницы ВК : https://vk.com/id281332657
  • ID события или встречи: https://vk.com/event9121

Выглядеть адрес страницы может так:


У одной и той же страницы ID только один!

Этот способ работает, даже если вас заблокировали.

Если он скрыт за короткой ссылкой, воспользуемся другими способами.

Кликните по аватаре в любом сообществе или просто на странице.
Чтобы понять, как узнать ID группы «ВКонтакте », внимательно посмотрите на адресную строку: «https://vk.com/readtube?z=photo-109561031_456239221%2Falbum-109561031_0%2Frev». АйДи — это девять цифр после «photo-».

Во время просмотра постов на стене можно быстро узнать АйДи — просто нажав на дату создания сообщения. Смотрим на строку адреса: https://vk.com/freshlife28?w=wall-88735354_5450. Между символами «wall-» и нижним подчеркиванием спрятан ID.

Сообщения

В адресе переписки с любым пользователем последние 9 цифр — его ID, например, https://vk.com/im?peers=273382122_158446797&sel=281332657.

Несложно выяснить идентификатор любого пользователя: друзей, подписчиков, известных личностей или медийных персон с помощью приложения https://vk.com/linkapp . Нужно зайти на страницу нужного человека и скопировать ссылку. Если человека нет среди друзей, найдите его с помощью поиска.

Потренируемся на известных личностях. У Полины Гагариной короткая ссылка выглядит так: https://vk.com/gagarinaofficial.

Интерфейс приложения крайне прост. В единственное поле вводите ссылку на страницу, АйДи которой нужно определить. Результат получаете одним нажатием на кнопку Узнать . Видим, что ID Полины 125254232.

Таким образом можно определить идентификатор страниц нескольких видов:

  • пользователя;
  • группы или паблика;
  • встречи.

Идентификатор можно скопировать и записать в файл или на бумагу. Информация и фотографии могут все время меняться, но если ID остается прежним, это один и тот же человек. Это может быть особенно полезно родителям подростков, которые постоянно меняют имя и фамилию в сети. Теперь вы знаете, как узнать ID новой страницы в ВК вашего ребенка.

В настройках профиля

Иногда у начинающих пользователей возникает вопрос, как узнать свой ID в ВК после включения короткой ссылки. Для этого следует проделать следующую последовательность действий:


Этот способ — самый удобный в приложении на телефоне.

Заключение

Бывает острая необходимость найти человека, группу или сообщество в социальной сети «ВКонтакте ». В этом вам поможет знание точного ID. Существует несколько способов его определения, которыми можно воспользоваться при различных ситуациях. Прочитав эту статью, теперь точно сможете определить необходимый АйДи.

Видео по теме

Очень часто пользовательский уникальный идентификатор, который в автоматическом режиме выдается системой, меняется людьми, в зависимости от личных предпочтений. После изменения ID ВКонтакте, узнать его возможно лишь несколькими способами, о которых знает не так уж много пользователей.

Уникальный номер в данной социальной сети несет большую пользу из-за того, что представляет собой постоянную ссылку на какую-либо страницу, изменить которую невозможно. Благодаря собственному ID вы без каких-то проблем сможете оставлять свои контактные данные другим людям, спокойно меняя при этом адрес своей страницы или группы на более приятное и запоминающееся сочетание символов.

Первым делом стоит отметить, что уникальный идентификатор выдается каждой созданной пользователями странице в этой соц. сети. То есть, ID имеется у совершенно любого пользователя, приложения, публичной страниц или группы.

Кроме того, идентификатор страницы остается закрепленным за человеком даже после полного удаления аккаунта. Если говорить более конкретно, то переход по ссылке, содержащей ID профиля удаленного пользователя или какого-либо сообщества, будет вас перенаправлять на сообщение о несуществующей или удаленной странице и система его никогда на привяжет к новым страничкам.

Администрацией ВКонтакте с самого начала существования этой социальной сети было объявлено, что идентификатор не подлежит каким бы то ни было изменениям.

На сегодняшний день вместо ID номера используется специальная ссылка, способная содержать различные символы. При этом, идентификатор все равно вполне возможно узнать несколькими методами, в зависимости от типа страницы.

ID своей страницы

Наиболее часто пользователи интересуются идентификатором именно персональной странички, как своей, так и других людей. Зачем требуется выявить ID номер – каждый решает сам для себя.

Если вам необходимо узнать собственный уникальный идентификационный номер аккаунта, но ссылка на главную страницу была вами сокращена через настройки, то лучше всего как раз воспользоваться интерфейсом редактирования личных данных. В этом случае, если придерживаться инструкции, дополнительных вопросов и неясностей у вас возникнуть не должно.


Чтобы удостовериться, что вы все сделали правильно, перейдите по полученной в вашем случае ссылке. Если вы оказались на своей собственной странице, значит процесс вычисления своего ID номера можно считать законченным. В противном случае перепроверьте свои действия, вернувшись к самому первому пункту инструкции.

Заметьте, что по умолчанию у всех зарегистрированных людей в качестве адреса на главную страницу установлен идентификатор. Таким образом, если вы не сокращали ссылку, то просто откройте свой профиль – ID будет в адресной строке браузера.

ID другого пользователя

В данном случае выявление идентификационного номера вызывает несколько трудностей, так как скорее всего вы не имеете доступа к настройкам страницы другого человека. Из-за этого инструкция по вычислению пользовательского ID сильно меняется, но все же остается легко доступной для понимания.

Единственным вашим ограничением на пути к выявлению номера чужого профиля является пользовательская блокировка вашей страницы другим человеком.


Удостовериться в правильности скопированного номера вы можете путем перехода по полученной ссылке. На этом рекомендации по выявлению уникального пользовательского идентификатора заканчиваются.

ID группы или сообщества

Намного чаще уникальные ссылки прописываются у групп и публичных страниц ВКонтакте, чтобы те обладали наиболее запоминающимся и коротким адресом. При этом, равно как и в случае с профилями пользователей, за каждой такой страничкой закреплен уникальный ID номер.

Главное отличие айди человека от номера группы или сообщества, состоит в том, что перед непосредственно самим числом используется специальное слово:

  • id – профили людей;
  • club – группы;
  • public – сообщества.

В случае с группами и пабликами, слово перед номером является взаимозаменяемым.

Вычисление идентификационного номера сообществ и групп выполняется полностью идентичным способом.

Не забудьте в обязательном порядке проверить работоспособность полученной в итоге ссылки, перейдя по ней. При каким-то проблемах – не паникуйте, а перепроверяйте свои действия.

Все названные методики выявления идентификаторов являются максимально удобными. Каких-то специальных расширений или программ для этих целей вы точно не найдете, так что ассортимент выбора средств сильно ограничен. Желаем вам удачи в вычислении ID ВКонтакте.

Социальные сети являются неотъемлемой частью жизни современных интернет-пользователей. В России огромной популярностью пользуется сайт «ВКонтакте». Здесь жители РФ и других стран общаются, отдыхают и даже работают. Иногда приходится думать над тем, как узнать ID «ВКонтакте». Что это за элемент такой? Для чего он используется? Где находится? Далее нам предстоит отыскать ответы на все перечисленные вопросы. Справиться с поставленной задачей способен даже школьник!

Что такое ID

Как узнать ID «ВКонтакте»? Сначала несколько слов о том, с чем нам предстоит иметь дело.

«АйДи» — это уникальный номер в социальной сети. Он служит идентификатором пользователя, группы или файла в «ВК». Это своеобразный короткий адрес той или иной страницы. Используется при пополнении счета «ВКонтакте», для поиска людей и добавления/удаления их из черного списка. Это крайне полезный элемент.

Но как узнать ID «ВКонтакте»? Что необходимо знать об этой процедуре? На самом деле никаких затруднений процесс не вызывает.

Страница пользователя

Стоит сразу отметить, что узнать номер телефона по ID «ВКонтакте» невозможно. Существует только одно исключение — когда мобильник написан в анкете пользователя. Но для этого придется заглянуть в профиль того или иного юзера. Больше никаких официальных и безопасных вариантов нет.

Начнем с собственного идентификатора. Чтобы его узнать, нужно:

  1. Зайти на vk.com.
  2. Пройти авторизацию в системе, используя свой логин и пароль.
  3. Кликнуть по строчке «Моя страница». Обычно эта страничка открывается по умолчанию.
  4. Посмотреть на адресную строку. ID пишется здесь после соответствующей надписи. Это уникальный набор цифр.

Идентификатор друга

Следующий вариант — это поиск ID друга. Прием предельно прост в освоении. И с ним сможет справиться даже начинающий интернет-пользователь.

Для того чтобы воплотить задумку в жизнь, юзеру необходимо просто зайти на главную страничку профиля своего друга и посмотреть на адресную строку браузера. ID отображается именно здесь.

Аналогичным образом можно увидеть уникальный идентификатор любого юзера, зарегистрированного в социальной сети. Все предельно просто и понятно.

Группа

Как узнать ID группы «ВКонтакте»? Подобный вопрос зачастую возникает у многих пользователей. И раньше он не вызывал никаких проблем. Человек мог всего за несколько секунд добиться желаемого результата.

Инструкция по извлечению «АйДи» паблика или группы имеет такой вид:

  1. Войти в социальную сеть «ВК». Это необходимо, чтобы доступ к группам был открыт на 100 %.
  2. Перейти в группу или паблик, идентификатор которого интересует человека. Например, путем клика по меню «Группы» и выбора подходящей странички.
  3. Взглянуть на адресную строку интернет-обозревателя. Здесь «АйДи» отображается после слова clud.

Вот и все. Никаких особых навыков и знаний процесс не требует. Но бывают исключения. О них поговорим позже.

Фото и видео

Как узнать ID «ВКонтакте» у фотографий и видео? Для этого необходимо следовать таким указаниям:

  1. Открыть в браузере нужный файл.
  2. Изучить надписи, появившиеся в адресной строке. Здесь будет подпись типа photoxxxxx_yyyy. YYYY — это и есть идентификатор фотографии или видеоролика.

Но это еще не все. Существует еще один интересный вариант решения поставленной задачи.

Уникальное имя и ID

Сегодня в «ВК» у пользователей есть право присвоения своим анкетам уникальных коротких имен. Это надписи, заменяющие ID. Они будут отображаться в браузере при переходе на ту или иную страничку. То же самое касается пабликов и встреч. Подобная ситуация затрудняет процесс поиска ID-номера.

Для реализации поставленной задачей юзеру нужно:

  1. Зайти на желаемую страницу. Например, пользователя или группы.
  2. Открыть любое фото или видео.
  3. Обратить внимание на строку адреса в интернет-обозревателе. Здесь появится надпись типа videozzz_nnn. ZZZ- это и есть «АйДи» группы или пользователя. Уникальные короткие имена в подобных адресах не отображаются. И этим можно воспользоваться.

Через настройки

Как узнать ID «ВКонтакте»? Если нужно получить информацию о собственной страничке, пользователям предлагается действовать таким способом:

  1. Открыть свой профиль и пройти авторизацию в социальной сети.
  2. В правом верхнем углу нажать на кнопку с изображением стрелки.
  3. Выбрать «Настройки».
  4. Пролистать появившуюся страницу до блока «Адрес вашей страницы».

Вот и все. Около надписи ID будет отображаться уникальный идентификатор профиля.

У вас возникла необходимость дистанционного управления программами вашего компьютера. Необходимо их авторизовать, запускать или удалять. Для удаленного управления работой программ с другого компьютера необходимо узнать ID компьютера. ID — это физический адрес вашей сетевой платы. С его помощью компьютер подключается к сети интернет.

Узнаем ID своего компьютера

  • Зайдите в меню «Пуск», затем в раздел «Панель управления». В открывшемся окне требуется найти значок с изображением монитора с галочкой на экране. Этот ярлык имеет название «Система» и отвечает за настройки системных значений работы компьютера. Для более опытных пользователей, для открытия данного окна, удобнее нажать сочетание клавиш Win+Pause/Break.
  • В появившемся окне перейдите по вкладке «Оборудование», далее «Диспетчер устройств». На экране представится полный список всех зарегистрированных устройств вашего компьютера. Здесь можно включать и отключать то или иное устройство при необходимости.
  • Чтобы узнать свой ID компьютера полностью найдите вкладку «Сетевые платы» и раскройте полный список, нажав знак «+», который находится слева от наименования подраздела. Здесь следует просмотреть свойства вашей сетевой платы, выбрав меню «свойства» из контекстного меню (один клик правой клавиши мыши по наименованию сетевой карты). В появившемся окне необходимо перейти на вкладку «Дополнительно» и выбрать подменю с названием «Сетевой адрес» (Network address). Должна появиться информация в виде: 00-00-00-00-00-00, где вместо «0» будут находиться цифры и латинские буквы, составляющие ваш ID адрес.
  • В некоторых случаях ID адрес отсутствует в свойствах сетевой карты. В этом случае необходимо прибегнуть к другому способу. На клавиатуре набрать сочетание клавиш Win и R. В диалоговом окне с черным фоном вписать команду «cmd», далее «Enter». Далее следует ввести команду для вывода свойств Ethernet адаптера – «ipconfig/all». ID адресом, в этом случае, будет информация напротив строчки «Физический адрес».

Такой параметр, как ID компьютера незаменим для дистанционной активации программ и привязки их к вашему персональному компьютеру. При этом появляется возможность блокировки запуска программ с удаленной машины. Это бывает очень полезно для родителей любознательных шалунишек, а вы теперь знаете, как узнать ID компьютера.

После регистрации вконтакте, каждый пользователь получает уникальный номер — id. Мы будем использовать его для многих операций — поиск человека, просмотр его фоток и видеозаписей (см. ), и многое другое.

Как нам узнать id определенного пользователя в вк ?

https://vk.com/id3667352

Https://vk.com/alinkafrolowa2000

В первом варианте — цифровое значение. Во втором — ник пользователя, который он настроил для своей страницы.

Как узнать id страницы в вк

Идем на страницу к нужному человеку. Когда она будет открыта, обращаем внимание на адресную строку браузера. Там после ссылки «vk.com» , будет стоять слэш. И после него id пользователя, в том варианте, в котором он его настроил.

В этом варианте все просто. Достаточно скопировать цифры после «id» . Это и будет искомое значение.

Немного сложнее, если человек настроил ник — буквенное именование для ссылки на свою страницу. Пример вы можете увидеть ниже.

Вы конечно можете скопировать ник. Но для большинства операций он не подойдет. Нужно знать именно числовое id .

Чтобы получить его, пойдем на небольшую хитрость. Нажмите на основную фотографию пользователя (см. ). Когда она откроется для просмотра, снова обращаем внимание на адресную строку. В этом раз мы увидим там следующее.

Https://vk.com/alinkafrolowa2000?z=photo226111938_410357713%2Falbum226111938_0%2Frev

Здесь нас интересуют цифры, после текста «z=photo. ..» . Вместо многоточия будет указан id данного пользователя в вк. В нашем примере это «226111938» .

Как изменить id вконтакте

Для этого идем в раздел «Мои настройки» . Здесь ищем пункт «Адрес Вашей страницы» .

Здесь в поле «Адрес страницы» , введите ник, который вы хотите использовать.

Как поменять ID «ВКонтакте» с компьютера и с телефона

Каждый пользователь, регистрируясь в той или иной социальной сети, получает свою новую персональную страницу. Для того, чтобы сделать ее более уникальной в общем списке других страниц, используется специальный идентификационный номер, который сокращенно называется ID. «ВКонтакте» его можно посмотреть в настройках или в адресной строке, находясь в своем профиле. При этом иногда у пользователей появляется необходимость в том, чтобы изменить свой ID.

Причины для изменения идентификационного номера могут быть следующими:

  • Пользователю просто не нравится его ID, либо он хочет, чтобы его страница открывалась по другой ссылке;
  • Пользователь желает поставить себе более красивый адрес страницы, который он выберет сам.

Как поменять свой ID «ВКонтакте» с компьютера?

Сразу стоит оговориться, что непосредственно сам ID ВК поменять нельзя, потому что он дается автоматически человеку после регистрации страницы и в дальнейшем является неизменным. Но при этом каждый пользователь может задать для своего профиля уникальный алиас, то есть адрес страницы, который он может придумать сам. Для этого нужно просто перейти в «Настройки», выбрав соответствующий пункт в раскрывающемся меню в правой верхней части.

После этого на вкладке «Общее» в графе «Адрес страницы» следует нажать на кнопку «Изменить».

Далее в появившейся строке нужно просто ввести новый адрес страницы и, если он не занят, можно нажать на кнопку «Занять».

Обратите внимание!

В данном адресе могут присутствовать только английские буквы, знак подчеркивания и числа.

После успешного изменения адреса появится соответствующее уведомление появится на странице настроек.

Как поменять свой ID «ВКонтакте» в приложении?

Тем, кто пользуется официальным приложением ВК, для начала нужно перейти на страниц настроек, выбрав значок с тремя полосками внизу и нажав на шестеренку в верхней части экрана.  

На открывшейся странице нужно выбрать пункт «Учетная запись».

Далее следует нажать на пункт «Короткое имя», чтобы указать новый адрес страницы.

В следующем окне можно указать новый адрес и, если приложение укажет, что оно свободно, можно нажать на значок с галочкой в верхней части экрана.

Далее приложение попросит подтвердить право пользователя на изменение этих данных через СМС-сообщение. Код будет отправлен в сообщении на мобильный номер, который использовался при регистрации. Запросить код можно, нажав на соответствующую кнопку.

Далее его нужно просто вставить в появившееся поле, после чего следует нажать на «Отправить код». После этого адрес страницы ВК будет изменен.

Как поменять свой ID «ВКонтакте» в мобильной версии?

На мобильном сайте m.vk.com сначала нужно открыть левое меню и выбрать здесь пункт «Настройки».

На следующей странице следует нажать на «Учетная запись».

Далее нужно выбрать строку с «Адресом страницы».

В появившейся строке следует ввести новый адрес и нажать кнопку «Занять» для подтверждения своих действий.

Заключение

Несмотря на то, что конкретно свой ID поменять «ВКонтакте» нельзя, каждый пользователь может придумать свой новый уникальный адрес для профиля. Если он окажется свободным (то есть его не используют другие пользователи), его можно занять, и он будет отображаться в адресной строке вместо стандартного ID.

Как поменять id вконтакте. Смена ID в контакте.

Как поменять id вконтакте – к этому вопросу вы, вероятно, не раз возвращались, общаясь с друзьями вконтакте. И в один прекрасный момент вы все же решаете, что вам надоел не очень интересный и неизвестно что выражающий набор цифр, идентифицирующий вас как пользователя, или, проще говоря, отражающий адрес индивидуальной странички. А в голове созрел какой-нибудь красивый «ник», или просто захотелось увековечить себя любимого (любимую), вернее свое имя, тем более что возможность такой смены id не очень давно появилась у пользователей вконтакте. Ею не замедлили воспользоваться все желающие.

И опять перед вами возник вопрос: как поменять id вконтакте со скучных цифр на красивое имя или свое собственное? Ну, что ж, посмотрим, как это делается. Обычно табличка с предложением о замене высвечивается вверху вашей страницы. Следуем согласно указаниям.

В том случае, если этой таблицы нет, то последовательность действий следующая : на вашей странице выбираете «Мои настройки», в них есть пункт «Адрес вашей страницы», жмете на кнопку «Редактировать адрес», видите надпись о том, что вы можете сменить адрес вашей страницы на более удобный для запоминания, который должен состоять из латинских букв, цифр, указанных символов, к сожалению специальные символы в контакте при составлении новога адреса страницы использовать нельзя.

Следующим шагом будет написание вашего красивого имени не короче пяти знаков (таковы требования администрации), пишете. Может оказаться, что кто-то вконтакте мыслит одинаково с вами, имя окажется недоступно. Придется придумать другое, фантазия поможет, тем более, что интересных конфигураций букв и цифр можно сочинить сколько угодно, не все же они будут заняты.

В конце концов, что-нибудь придуманное вставляете. Имейте в виду, что есть вероятность того, что новый адрес нельзя будет зарегистрировать из-за ограничений со стороны администрации сайта. Причины она не объясняет. Будем думать, что это не наш случай. После того как адрес наконец готов, регистрируем его. Затем мы должны будем привязать номер вашего мобильного телефона к странице. После ввода номера телефона, на него придет СМС с набором цифр, их нужно ввести в специальное поле. Все готово, вы видите свой новый адрес страницы с придуманным вами именем.

Обратная процедура: поменять имя на id в настоящее время недоступна. Сам id никуда не денется, его можно видеть в адресе вашей страницы «Ваш номер».
Если вы обнаружили свободный id, например, под цифрой 13, заменить старый на него нельзя и зарегистрироваться под ним тоже. Не отчаивайтесь! Главное вы теперь знаете ответ на вопрос, как поменять id вконтакте на имя, а с красивым именем жить все же приятнее, чем под номером.

Поделитесь информацией с друзьями Вконтакте с помощью специальной кнопки

Советуем также обратить внимание:

  • Как сменить день рождения ВКонтакте?
  • Совершенно секретно: как поменять пароль ВКонтакте
  • ВКонтакте обновления: что это и для чего
  • Как вернуть страницу ВКонтакте
  • Плагин для Оперы ВКонтакте
  • Как поменять id в ВК на слово или цифры?

    Каждая пользовательская страница Вконтакте имеет свою уникальную ссылку (id). Если вы не изменяли настройки профиля, то она выглядит как idxxx. Где место «xxxx» указан числовой номер.

    Как быть, если вам такая ссылка не нравится? Можно что-то сделать? Да, можно. Сейчас я покажу вам, как поменять id в ВК. Научу это делать для своей страницы и для группы.

    Оглавление:

    1. Меняем id для страницы
    2. Теперь для группы
    3. Видео урок: как изменить id вконтакте
    4. Заключение

    Меняем id для страницы

    Я уже объяснял вам, как узнать id пользователя вконтакте. Теперь давайте научимся его менять.

    Идем на свою страницу и открываем настройки.

    Здесь нам нужен раздел «Адрес страницы». Там нажимаем на ссылку «Изменить».

    У вас откроется форма, где можно вводить новое id. Это может быть слово или набор цифр. Укажите нужное значение, и нажмите кнопку «Изменить адрес».

    Теперь для группы

    Открываем раздел «Группы», и переходим в сообщество, для которого нужно изменить ссылку (см. как создать группу вконтакте).

    На странице сообщества открываем меню, и выбираем раздел «Управление сообществом».

    Откроется меню. Найдите раздел «Адрес страницы», и здесь укажите нужное значение id (см. id группы вконтакте). Затем нажмите «Сохранить».

    Видео урок: как изменить id вконтакте

    Заключение

    Читайте также:

    Кстати, текст ссылки имеет небольшое значение, для поискового продвижения страницы или группы (см. как раскрутить группу вконтакте). Поэтому, если вы планируете получать трафик из поисковых систем, прописывайте ссылку таким образом, чтобы она подходила под группу запросов, которые вы выбрали для продвижения.

    Вопросы?

    Вам помогла эта информация? Удалось решить возникший вопрос?

    Понравилась статья? Пожалуйста, подпишитесь на нас Вконтакте!

    Facebook

    Twitter

    Мой мир

    Одноклассники

    Google+

    Загрузка…

    Как узнать id (айди) страницы ВК (ВКонтакте)? И как поменять свой id (айди) ВК?

    Здравствуйте!

    Вы уже много узнали про соцсеть Вконтакте: как бесплатно зарегистрироваться, что такое страница ВК, как поменять пароль от страницы и как заблокировать человека. А также разбирали и другие вопросы, справа от статьи есть рубрика Вконтакте, вы можете найти там ответы на интересующие вас темы по ВК, или же воспользуйтесь поиском.

    Оказывается, много пользоваталей ВК также не знают ответы на простые вопросы, такие как: то такое айди, как узнать id (айди) страницы ВК, как поменять свой  id (айди), как можно узнать id (айди) любой группы или страницы.

    А вы знаете, как посмотреть айди? Если нет, приглашаю вас ознакомиться с данной статьей.

    Зачем вам нужно знать свой id (айди) — знать его очень важно, так как при обращении в службу поддержки ВК, у вас потребуют эти данные. А также очень удобно давать свой айди друзьям, если они не могут вас найти по поиску.

    Давайте разберем все с самого начала, что же такое айди и с чем его едят))

    Содержание статьи

    1. Что такое айди (id) ВКонтакте?
    2. Как узнать id (айди) страницы ВК (ВКонтакте)?
    3. Как поменять свой id (айди) ВК?
    4. Как узнать узнать id (айди) друга/другого человека?
    5. Как узнать узнать id (айди) любой группы или страницы?

    Что такое айди (id) ВКонтакте?

    Как и в любой социальной сети, в том числе в в ВК каждому пользователю присваивается свой уникальный номер, который состоит из цифр. Айди (id) — это порядковый номер вашей странички ВК, эти цифры и есть Айди (id) вашей страницы ВК.

    Как узнать id (айди) страницы ВК (ВКонтакте)?

    Самый простой способ — это зайти на свою страничку и в строке браузера посмотреть свой  id (айди). В данном случае мой айди —  это цифры после букв id.

    Также можно посмотреть айди вашей странички, зайдя в левую панель меню МОИ НАСТРОЙКИ—ОБЩИЕ и почти в конце странички будет надпись АДРЕС ВАШЕЙ СТРАНИЦЫ.

    Возможно, вы замечали, что у некоторых пользователей ВК нет в айди цифр, а есть буквы. Вы можете тоже изменить свой id.


    Как поменять свой id (айди) ВК?

    Изменение своего айди не занимает много времени. Минус айди в том, что он и правда состоит из нудного номера, и друг не может его запомнить, когда будет вас искать по поиску , и ему придется где-нибудь его написать, и вот тогда уже пригодится изменение своего айди, чтобы он был легким в написании и красивым.

    Вы можете поменять свой айди ВК с цифрового на текстовой. Использовать в названии айди можно только английские буквы и цифры. А также ваш айди должен быть уникальным (т.е. 2 одинаковых айди не бывает). В случае смены айди. у вас все равно остается цифровой айди, который вам был присвоен при регистрации в ВК, просто его не видно.

    Для того, чтобы изменить свой айди ВК, вам нужно зайти в левой панели страницы МОИ НАСТРОЙКИ—ОБЩИЕ, в графе АДРЕС СТРАНИЦЫ ввести вместо надписи id… свой новый айди, например, zoob1892  и нажать ИЗМЕНИТЬ АДРЕС.


    Как узнать узнать id (айди) друга/другого человека?

    Для этого зайдите к другу на страничку и сразу же в строке браузера вы увидите ссылку на есть страничку и его айди.

    Например, если адрес чужой страницы такой:

    http://vk.com/id88888888

    …то здесь id88888888 — это и есть чужой айди.

    Как узнать узнать id (айди) любой группы или страницы?

    Для этого зайдите в группу или на страницу паблика и сразу же в строке браузера вы увидите ссылку на группу/паблик и айди группы. Аналогично как и у вашей странички и у странички вашего знакомого.


    Читайте и другие темы по соц.сети ВКонтакте для новых пользователей ВК:

    Что такое МОЯ страничка ВК?

    Как поменять пароль на страничке ВК?

    Как посмотреть друзей ВК? Посмотреть скрытых и просто друзей друга во Вконтакте (ВК)?

    Как скрыть свою страницу ВКонтакте, фото, альбомы, видео, стену, друзей, группы?

    Как заблокировать человека в Вконтакте (ВК)? Черный список ВК

    Как узнать id (айди) страницы ВК (ВКонтакте)? И как поменять свой id (айди) ВК?

    Как найти нужную информацию в переписке ВКонтакте? Поиск по диалогам ВК

    Как удалить друга из друзей ВКонтакте (ВК)?

    Если ваша страница вдруг будет заморожена, вот здесь я рассказываю, Как можно Восстановить доступ к страничке ВК. И также можете прочитать, если вам надоест эта социальная сеть, Как можно удалить свою страничку ВК?


    А также я Вас приглашаю вас в свою группу Вконтакте БЛОГ ЛЮБОВИ ЗУБАРЕВОЙ, вступите в нее для того, чтобы оперативно узнавать о новых видео и статьях, а также можно пообщаться по темам моего блога.

    Читайте и другие статьи по социальным сетям Вконтакте, Одноклассники, Инстаграмм и другим в рублике на моем блоге СОЦИАЛЬНЫЕ СЕТИ.

    Если вас интересует возможность бесплатного продвижения в этих социальных сетях: ВКонтакте, Одноклассники, Твиттер, Инстаграм, YouTube, Фейсбук, рекомендую вам ознакомиться с этой статьей.

    С уважением, Любовь Зубарева

    Поделитесь статьей в социальных сетях:


    Подарок и новости блога, жмите ниже:

    Email*

    ПОЛУЧИТЬ

    Как узнать и изменить id Вконтакте группы

    Вконтакте — одна из самых популярных и модных социальных сетей. На данный момент сайтом пользуются более 160 миллионов людей разных возрастов и национальностей.

    После того, как вы прошли регистрацию вам присваивается уникальный идентификационный номер или ID. Проще говоря ID — это персональный номер вашей странички.

    В этой статье мы подробно расскажем вам о том, как узнать свой id Вконтакте и как изменить id Вконтакте?

    Узнать ID своей странички очень легко.   Вам просто нужно нажать вкладку «Моя страница» и в адресной строке появится ваш id:

    В браузерной строке появится адрес с id. Например, id123456789 — это и есть индивидуальный номер вашей вк страницы. Вот и все премудрости, чтобы узнать, как изменить свой ид вконтакте.

    Вконтакте у каждого пользователя свой ID.

    Как изменить id Вконтакте

    Полностью поменять id нельзя, изменить можно только его название. Помните, что поменяв название id вы все равно сможете попасть на вашу страницу введя первоначальные данные, то есть цифры. Как изменить ид вк — читайте ниже.

    1. Открываем «мои настройки».Во вкладке «Общее» есть графа «Адрес Вашей Страницы». Здесь вы сможете изменить свой id.ID может состоять из латинских букв, цифр и знаков. 
    2. После ввода нового ID, нажимаем «Занять адрес» и занимаем его, скорее даже бронируем, пока не подтвердили.
    3. Далее, подтверждаем изменения с помощью смс-кода. Чтобы получить код нужно нажать кнопку «отправить код» и он придет на номер, который привязан к странице. Затем его нужно ввести во всплывшее окно подтверждения.
    4. Вот и все что нужно сделать, чтобы уметь и знать как поменять ид вконтакте . Адрес успешно изменен и будет выглядеть так, как вы его написали.

    Так же способом можно изменить или посмотреть ID группы.

    Как изменить id группы вконтакте

    Если вы сами являетесь администратором и создателем какого-либо сообщества, то вы можете сделать креативный ID для привлечения пользователей.

    Как изменить id группы вконтакте: id своей групы вы сможете изменить зайдя в раздел «Управление сообществом«, далее вы увидите «адрес страницы«:

    Лучше всего придумать короткое, но кричащее и запоминающееся название, ведь от заголовка зависит очень много, а ВКонтакте является текстовой социальной сетью, поэтому не забывайте, что тут читают.

    Если Вы администрируете свои группы, то они нуждаются в продвижении. У нас есть накрутка групп, а также раскрутка групп Вконтакте. Происходит продвижение благодаря накрутке подписчиков в заданное сообщество. Тем самым остается только добавлять интересные посты и наблюдать прирост новых подписчиков в сообщество.

    Напомним, что полностью ID вы не меняете, вы меняете его название, и если кто-то запомнил начальный цифровой id вашей группы, то он без труда попадет на страницу вашей группы по первоначальному адресу.

    Надеемся, что наша подробная инструкция поможет вам без труда придумать интересное название своей странички Вконтакте.

    ID группы. Как узнать и изменить.

    Продолжаем цикл статей о создании и развитии вашего сообщества в ВК. Сегодня мы ответим на вопрос: как узнать id группы вконтакте. У каждого сообщества есть свой уникальный адрес в данной социальной сети, который идет после знака «/», так называемый id номер публичной страницы, группы, или мероприятия.

    Многие ошибочно полагают, что id vk групп может быть написан латинскими буквами, но на самом деле это всего лишь преобразованный числовой адрес вашего сообщества в буквенный формат, сделано это для того, что бы можно было легко запомнить адрес группы.

    Например, /public41046738 куда сложнее  запомнить, чем http://vk.com/idea3. Хотя, оба адреса будут вести вас на одну и ту же страницу. Такой способ преобразования адреса страницы называется ЧПУ, т.е. человеко понятный URL.

    В данном случае id публичной страницы выделен красным.

    Зачем нужен Ай-ди? Чтобы компьютер «знал», как открыть нужную ссылку.

    Как узнать id в контакте?

    -Что бы узнать ид в ВК, достаточно открыть любой пост на стене и посмотреть какие цифры стоят в адресе страницы между словом wall и знаком «_».

    Пример: wall-41046738_707

    Красным цветом выделен id данного сообщества.

    -Если вам нужно получить group id vk.com сразу в большом количестве, например пары сотен сообществ, то можете воспользоваться программой VKDomainToIdConverter, которая в считанные секунды выдаст вам числовой ID сообщества в вконткте.

    Теперь вы знаете как узнать id адрес вконтакте любого сообщества.

    Как сменить id вконтакте?

    Никак. Поменять id адрес ни сообщества, ни личной страницы невозможно. Он дается вам один раз и навсегда. Единственное, что вы можете сделать-изменить ЧПУ вашего сообщества. То есть адрес (id) останется прежним, а видимый адрес изменится и станет «красивым».

    В этой статье мы говорили только о том, что такое id и как узнать id группы вконтакте, а в следующей статье мы разберем «как узнать id личной страницы и id друга«.

    MEROPS — База данных пептидаз

          25 26 27 28 29 30 31 32 33 34 35 36 37 38 39
         845678456784567ABCDEFGHIJK8901ABC234ABCD5ABC67A890AB12345ABCDEFGHIJKLMNOPQRSTUVWXY67ABCDEFGHIJ890ABCDE123456789ABCDEFGHI01234567ABC8ABCD901ABCDE234567890A12ABCD34AB567890ABCDEFGHIJKLMNOPQ12345678ABCDEF4A56AB7845678456ABCDEFGHIJ784567890
                                                   + #  +  +
                                                                                                                                                                                                                                                                                        
       1  EPFSYDPFNRDAYLTSSF  G  ENRGTR  ----------------  Y  H  A  G ---  I  D  Y  ----  S  - -  TL  -  MEEGW  P  IY  A  P  -------------------------  EN  ----- ----- G  YV  -----  R  E  IKT  S  PF  G ---------  Y  G  KVMFFE  --------  GES  -----  GKTWVFA  H  Q  -S  SFPQTIENLISQKQ  Y  ATQNNDISIKPNLR  ---  FRK  G  DTLTF  SGST ------ G  P  H  LH  LEVRL  -------------  NKDIVVS  P  CQVGVKCLDT  - 1
       2  VVFSAPVDSPRVSATF  G  EYRGSGNRGPH  -----------  F  H  M  G ---  I  DF ----  S  ---  TG  -  LKEGV  P  IY  A  S  -------------------------  ER  ---------- G  WL  ----- V  RIEIDEDDI  --------  Y  G  YTVV  L  E  ---  H  ----  EN  G -----  YRTL  -Y  A  HL-S  RFSKKLETVASSLKQEFGNVRIVVNFPEKEIWFEK  G  EVV  G  Y  SG  T  T ------ G-  EA  -  PI 9000  P  P 9000 EIRD  ------------  RNEEVSY  DP  ST  FL  NLPKPVDE  2
       3  WYKNLSGGGGGGLQLAQFPMDIINISQGEN  --------  GSFS  H  K  G  TLCI  DF --------  VG  -  KTEKY  P  YY DC ------- G  SV  ----------------------------------  R  - ----------  YITWVNV  H  E  -S  P  ----  LP  -  FD  VG  KK  ------------ -----  L  K  K  G  DLM  G  HT  G  IG  ------ G-  NV  --T  GD   H   W  HF  NVIDGKEYQGW  -------------------------- 3
       4 -------------  ISS  G  F  G  WRFH  P  IFRRRA  -----------  F  H  T  G-- -  I  D  I  ----  V  ---  TF  -  W  G  A  --PV  Y  A  T  ----------- --------------  AD  ---------- G  IV  -----  SYV  GW  ESG  ------- ---  Y  G  KV  I  KIN  ---  H  ----  GR  G -----  IVTY  -Y  A  HL-S  S  --- -Y  A  --V  S  VG  QF  ----------------- VK  K  GQ  F  IG  RV  GST ----- -G-  T  S--  IG  P  H  LH  YEVRR  ------  GGN  --------  PVN  P  ATY  L ----- --- 4
       5 -------------  VTSQ  YG  WRRR  ---  GRYK  --------  E  -  F  H  A  G-- -  I  D  I  ----  A  ---  AP  -  T  GT - PV  V  A  T  -------------- -----------  AD  ---------- G  VV  -----  IFS  GW  VR  -G -------- -  Y  G  YV  I  VIY  ---  H  ----  GY  G -----  YTTV  -Y  A  HL-S  G  ----  RE  -  GYK  GD  L  ----------------- V  AK  G  SV  IG  YI  GST ------ G-  RA  --T  G  P  H  LH  YEVLK  ------  YGI  --------  RQN  P  ILY  L  P  ------ - 5
       6 -------------  ITSYF  G  WRIS  P  F  G  GGWE  -----------  F  H  K  G-- -  I  D  I  ----  A  ---  SY  -  Y  G  A  --P  IR  A  A  ----------- --------------  AD  ---------- G  EV  -----  TF  AGW  DSG  G ------ ---  Y  G  KM  I  IIY  ---  H  ----  R  DG -----  IETV  -Y  G  HL-S  G  --- -  ID  --VKVGD  K  ----------------- VK  K  GQ  V  IG  YE  G  C  T ------ G-  LC  --T  G  P  H  LHF  EIR  V ------  WGE  --------  VIN  P  L  ------ ----- 6
       7  NDEKFFIWPVYGVISS  G  F  G  WRIH  P  ITGKYS  -----------  F  H  S  G --- VD  I  ----  S  - -  AP  -  E  GT - P  IF  A  A  -------------------------  E  S- --------- G  VV  -----  EF  AG  KNG  -G ---------  Y  G  LM  I  KIK  --- -----  SAS  -----  YEHI  -Y  G  HL-S  Q  ----  ID  --V  YE  G  Q  Y ----- ------------ VK  K  GQIIG  RV  G  N  T ------ G-  L  S - T  G  P  H  LHF  EVR  В ------  NQK  --------  AVN  P  INY  L  PNQIWV  - 7
       8 -------------  ISSSF  GY  RIS  P  FTGRRV  -----------  F  H  E  G ---  L  D  I  ----  A  ---  NK  -  M  GT - P  IRSA  ---------------------- ---  AK  ---------- G  VV  -----  IFS  G  RKA  -G ---------  Y  GN  V  I  TID  ---  H  ----  GF  G -----  YVTR  -Y  A  H  C  -  N  K ----  LF  -  M  K  E  GD  N  ----------------- V  EK  GQ  V  I  AEV  G  N  T ------ G-  R  S - T  G  P  H  LH  YEVL  V ------  NGV  --------  QVN  PM  K  F  II  - ------ 8
       9 -------------  ITS  G  F  G  IRRH  P  ILGGAP  --------  L  -  F  H  T  G --- VD  I  ----  A  ---  AS  -  Y  GT - PV  R  A  A  --------------- ----------  A  S ---------- G  R  I -----  IF  AGW  YG  -G ------- -  Y  GN  MVIID  ---  H  ----  GGK  -----  ISTV  -Y  G  HL-SK ----  IV  -  AR  VG  EE  -----------------  IAE  G  D  IIG  YV  G  T  T ------ G-  L  S- -T  G  P  H  LHF  EVR  V ------  NGD  --------  PV  DP  LSW  L -------- 9
      10  RG  T  GVMAYPSDASTSSPF  G  WRIH  P  ILGYRR  -----------  F  H  A  G ---  L  DF ----  A  - -  AS  -  Y  G  S  -  KIR  A  A  -------------------------  D  S ---------- G  RV  -----  IF  AGW  YG  -G ---------  Y  G  RAVIID  ---  H  ----  GN  G -----  LTTL  -Y  G  H  T  -S  E  ----  LY  --V  SE  G  QA  - --------------- V  ER  GQ  A  IG  AV  GST ------ G-  F  S - T  G  P  H  LHF  EVRR  ------  NGT  --------  PV  DP  ЛЮБЫЕ  L -------- 10
      11 ------------------------------------------ H  D  G-- -  L  DF ----  A  ---  AP  -  Y  GT - PV  H  A  T  ----------------- --------  G  S ---------- G  VV  -----  AQ  AGW  MG  -  P  -------- -  Y  G  LAVL  L  D  ---  H  ----  AE  G -----  YQTL  -Y  G  HL-S  R  ----  LL  --V  RP  G  ER  ----------------- V  ER  GQ  VL  G  YV  GST ------ G-  R  S - T  G  P  H  LH  YSVYR  ------  RGV  --------  AV  DP  RRY  -  LDPA  ---- 11
      12 -------------  ITTYF  G  GR  -----  GAFQ  --------  R  -  Y  H  T  G ---  I  D  L  ----  A  ---  AP  -  Y  GT - P  IV  A  A  ------------ -------------  K  S ---------- G  QV  -----  QV  AGWS  SF  G ------ ---  Y  G  FHVV  L  D  ---  H  ----  GG  G ----- V  ETL  -Y  A  H  M  -S  R  ----  IA  --V  RP  G  QW  ----------------- V  E  AG  DL  IG  YV  GST-- ---- G-  W  S - T  G  P  H  LHF  EVR  V ------  NGV  --------  PRN  P  LAY  L -------- 12
      13 ---------------- G  F  G  PRWG  ------ G -----------  F  H  N  G ---  I  D  I  ----  A  ---  NR  -  AW  T - P  IV  A  A  ----------- -------------- SS ---------- G  RV  -----  R  EAGW-  CS  G ------- -  Y  G  YCVKIR  ---  H  ----  PG  G -----  IETI  -Y  G  HL  IAQ  ----  PV  --V  R  VG  QE  ----------------- V  S  AGQ  L  IG  YM  GST  YDRAGG  G-YS - T  GV   H  LHF  TIL  V ------  NGR  --------  AVN  P  LRY  L -------- 13
      14 -------------  LTS  G  F  G  WRNS  P  F  -  GV  G  R  --------  D  -  F  H  P  G ---  I  D  I  ----  A  ---  GR  -  V  G  L  --PV  I  A  T  - ------------------------  A  S ---------- G  VV  -----  SFS  GW  DQ  -G ---------  F  G  KSVRID  ---  H  ----  AN  G -----  FETL  -Y  A  HL -  DQ  ----  VV  --V  YENEK  ----------------- V  TR  G  E  IIG  YL  G  N  T ------ G-  L  S - T  G  P  H  LH  YGVLR  ------  NRV  --------  PV  DP  TRYIID  ------ 14
      15  R  A  AFLRAPLAFRRISSVF  G  LRRH  P  ILGVTR  -----------  A  H  Q  G ---  T  D  Y  ----  A  ---  AA  -  A  GT - PV  R  A  L  -------------------------  GD  ---------- G  RV  -----  IF  AGW  KG  -G ---------  Y  G  RV  I  EIR  - -  H  ----  TN  G -----  YVTR  -Y  G  HL-  KG  ----  FASGI  K  A  G  TS  ---- ------------- V  AISRT  IG  FV  G  A  T ------ G-  LA  --TAP  H  LHF  EVL  V-- ----  GGK  --------  HR  DP ------------ 15
      16 -------------  ISSPF  GY  RMH  P  ILHTWR  -----------  L  H  T  G ---  I  D  Y  ----  A  ---  AP  -  Q  GT - PV  R  A  S  ------------------ -------  AD  ---------- G  V  I -----  TFK  G  RKG  -G ---------  Y  GN  AVMIR  ---  H  ----  SN  G ----- V  ETL  -Y  A  HL-S  A  ----  FS  -  QAQ  G  N  ------------------ V  RG  G  EV  IG  FV  GST ------ G-  R  S-- T  G  P  H  LH  ГОД  ------  NG  Q --------  PVN  P  VSVALPTPEL  - 16
      17 -------------  ISSY  YGY  RRD  P  F  -  TKKR  --------  A  -  F  H  S  G ---  I  D  I  ----  V  ---  AR  -  Y  G  A  --PV  R  A  T  --------- ----------------  AD  ---------- G  VV  -----  YRV  G  YTR  -  A  - --------  L  G  RYVKIR  ---  H  ----  AH  G -----  FMTV  -Y  G  HL-  R  K-- --Y  V  --VK  R  G  ER  ----------------- V  QK  G  E  IIG  YV  G  N  T ------ G-  R  S - T  G  P  H   V  H  YEIRR  ------  WGR  --------  SLN  P  LR  F  V  -------- 17
      18 -------------  ISSR  YG  PRIH  P  ITGRPS  -----------  F  H  A  G ---  Y  D  I  ----  A  ---  NV  -  E  GT - PV  F  A  P  ------------------ -------  AP  ---------- G  VV  -----  SR  AG  ярд  N-  L  ---------  A  GN  Y  I  EIR  ---  H  ----  QH  G -----  FTTR  -Y  I  HL-S  E  ---- Y  V  -  LER  GD  Q  ----------------- V  LG  GQ  L  IG  YM  G  N  T ----- -G-  R  S - TA  S   H  LH  YEIHY  ------  RGR  --------  HV  DP  RG  FL ----- --- 18
      19 -------------  VTSEF  G  MRFH  P  ILHIMR  ----------- MH  D  G ---  I  D  I  ----  A  ---  VP  -  T  GT - PVKA  S  -------------------------  A  S ---------- G  T  I -----  IATK  W  LE  -G ---------  Y  GN  VVIVS  - -  H  ----  GQN  -----  FSTL  -Y  A  HL-  KS  ----  FA  --VK  E  G  QE  --- -------------- VK  Q  GQ  V  I  AY  S  DN  T ------ G-  W  S - T  G  P  H  LHF  SIYKIDPETGKSM  --------  PVN  P ------------ 19
      20 -------------  ITS  GYGY  R  P  D  P  FTGVIS  -----------  F  H  N  G-- -  I  D  I  ----  A  ---  NL  -  AN  T - P  I  KA  S  -------------- -----------  RE  ---------- G  V  I ----- V  T  AG  FNAG  G ------- -  Y  G  KY  I  VIS  ---  H  ----  SN  G -----  FQTL  -Y  A  HL-  NS  ----  FA  --VKVG  KK  ----------------- V  SR  G  AV  IG  YM  GST ------ G-YS - T  GN   H  LHF  TIFK  ------  NGK  --------  TEN  PM  KY  L  R  ------- 20
      21 ------------------------------------------ H  T  G-- -  I  D  I  ----  Q  ---  GA  -  RH  T - P  IR  A  A  -------------- -----------  RA  ---------- G  QV  -----  IF  AGW  M  NG ---------  Y  G  RVVVTR  ---  H  ----  DSV  -----  SSTL  -Y  A  H  A  -  QT  ----  LK  - V  CK  G  QQ  ----------------- V  S  AGQ  V  I  ATV  G  TS  ------ G-  R  S - T  G  P  H  LHF  EIRL  ------  NNK  --------  PTN  PM  SY  L  R  ----- - 21
      22 ----------------------------------------- MH  T  G ---  I  D  L  ----  P  ---  AP  -  K  GT - PVKA  A  ------------------- ------  GD  ---------- G  VV  -----  LY  AGW  IR  -G ---------  Y  G  QIVI  L  D  ---  H  ----  GNQ  -----  MSTV  -Y  A  HL-S  A  ----  IT  --V  QE  G  AK  ----------------- V  S  AG  NTV  G  RV  GS  S  ------ G-  VA  --TA  T   H  LHF  EVRI  ------  GGT  --------  AKN  P  VDY  L -------- 22
      23  LFGWRVHPITG  -  NQRF  ------------------------- H  A  G ---  T  D  L  - ---  G  ---  AP  -  T  GT - PV  L  A  A  ----------------------- -  AA  ---------- G  QV  -----  ET  A  N  W  MG  -G  Y  --------- G  LTVI  L  N  ---  H  ----  KSA  -----  EQTL  -Y  G  H  M  -S  E  ----  IL  - -V  QP  G  QW  ----------------- V  QP  G  TL  IG  RV  GST ------ G-  A  S - T  G  P  H  LHF  EVRHLTPNGWV  A  TDPGVELQSALSQ  ------------ 23
      24 -------------  ITLHF  G  PAIE  P  FTRQWY  -----------  I  H  K  G ---  I  D  L  ----  G  ---  GVR  IGT - P  IV  A  T  ---------------------- ---  AD  ---------- G  EV  ----- V  R  A  SYQSA  G ---------  Y  GN  FVQIK  ---  H  ----  KY  G -----  LATL  -Y  A  H  M  -S  R  ----  L  N -  TSK  G  S  Y ----------------- VK  K  GQIIG  FM  G  Q  T ------ GY  A  --T  G  P  H   V  H  YEVR  V ------  GS  Q --------  VIN  P  DMY  L  NL  A  TGASK  24
      25  LI  -  W  ---  PTQGFISQGFRK  Y  Q  --------------------- H  E  G ---  I  D  I  ----  A  ---  GA  -  S  GT - PV  V  A  A  ------------------ -------  A  S ---------- G  TV  ----- V  K  AGW  D  N  W  G  L  ---- ----- GN  A  I  TIK  ---  H  ----  L  DG -----  STTV  -Y  G  H  N  -  RR  - -  LL  --V  SKNQQ  ----------------- V  IQ  GQII  AEM  GST ------ G-  N  S- -TAP  H  LHF  EVH  ---  PNGRI  A  VDP  -  LRLLTSLTASV  ---------- 25
      26  PIDELTPVPSSSTVASR  Y  TW  --- P  AKGTLTSGYGWRWGR  --MH  K  G ---  I  D  V  ----  A  ---  NS  -  T  -  T  --PV  В  A  S  -------------------------  AE  ---------- G  T  I -----  EK  AGW  N  N  G  G ---------  Y  GN  LVEIR  ---  H  ----  P  DG -----  STTR  -Y  A  H  N  -SK ----  IL  --V  QP  G  QQ  -------------- --- V  HQ  G  ET  I  ALM  GST ------ G-  H  -  S  T  G  P  H   T  HF  EIHPS  ---  GKG  A  V  ----------  N  P  IAM  L  PDRI  ---- 26
      27 --------------------------- N  YT  --------  M  --- H  N  G ---  I  D  Y  ----  A  -  PFKR  -  EN  T - P  IF  A  A  ------------- ------------  GK  ---------- GK  V  ----- V  F  A  QNRE  -------  L  ---  T  GN  TLIIQ  ---  H  ----  LP  G ----- V  FTI  -Y  L  HL-SK ----  LG  -  ISENKI  ----------------- V  S  AG  EY  IG  HT  G  N  T ------ G-  L  S - T  G  P  H  LHF  EV  -------------------------  RINGIA  ---- 27
      28  G  ---------------------------  YP  --------  G  --- H  V  G --- VD  Y  ----  A  ---  VP  -  V  GT - PV  R  A  V  ------------ -------------  AN  ---------- G  TV  -----  KF  AG  NGANHPWMLWM  ---  A  GN  CVLIQ  ---  H  ----  A  DG -----  M  H  TG  -Y  A  HL-SK ----  IS  --V  STDST  - ---------------- VK  Q  GQIIG  YT  G  A  T ------ G-  QV  --T  G  P  H  LHF  EMLPANPNWQNGFSGRIDPTGYIANA  P  VFNGT  ----- 28
      29 --------  LFGDYRT  -------------  YYYKGKKIGNA  -  Y  H  M  G ---  I  D  L  - -  A  ---  SV  -  A  G  A  --PV  P  A  A  --------------------- ----  A  S ---------- GK  V  ----- V  F  A  DYLGI  ----------  Y  GN  T  I  IID  ---  H  ----  GY  G -----  LFSL  -Y  A  HL-S  G  ----  FT  --V  AK  GD  M  ----------------- VK  R  GQ  L  IG  YTDT  T ------ G-  LA  -  GGD   H  LHF  SVL  V ------  QGV  ------------------------ 29
      30 --------  LYGEKRI  -------------  YTYGGKQISTS  -  Y  H  W  G ---  Y  D  L  - -  A  ---  SV  -  KNS  --PV  E  A  S  -------------------------  N  S ---------- G  RV  ----- V  FT  G  FLGI  ----------  Y  GN  TVIID  - -  H  ----  GY  G -----  LMSI  -Y  S  HL-  AE  ----  FR  --VK  E  GD  I  --- -------------- VK  K  GQIIG  VTDT  T ------ G-  LA  -  FGD   H  LHF  GI  M  I  ------  NGL  ------------------------ 30
      31  D  A  LPAIIPTTGGYSIE  G  F  G  MRMH  P  ILKVMK  --------  M  --- H  E  G ---  L  D  I  - ---  L  ---  TD  -  V  G  S  --PV  F  A  P  -------------------- -----  GN  ---------- GKI ----- V  YV  G  PRG  -------  G  ---  Y  G  LTVEVE  ---  H  ----  GF  G -----  YKTV  -  FA  HL-SK ----  AL  --VK  E  G  QT  - --------------- VK  R  G  DR  I  ALT  G  NS  ------ G-  L  S - T  G  P  H  LH  YEV  -------------------------  H  L  NGIPQDPI  31
      32 ------------------------------------------ H  R  G-- -  I  D  I  ----  G  ---  EK  -  F  G  A  -  E  V  RSA  ------------ -------------  VK  ---------- G  IV  -----  TYS  G  EKG  -  N  ---- -----  Y  G  KMVEVT  ---  S  ----  EK  G -----  IVTR  -Y  A  HL-SK ----  IS  - -V  EE  G  EI  ----------------- V  SQ  G  Y  I  L  G  NV  GST ------ G -  M  S - T  G  P  H  LHF  EI  M  I  ------  DGK  --------  PL  DPM  E  F-- ------- 32
      33 -------------  ITSPF  G  KRKSQM  -  GT  G  E  --------  E  -  F  H  P  G ---  I  D  I  ----  A  ---  QK  -  V  GT -  V  V  M  A  P  --------- ---------------- S  D  ---------- G  FV  -----  LQT  G  FAS  -  D  ---------  Y  G  RYVM  L  F  ---  H  ----  GM  G -----  LTSI  -Y  A  HL-  G  K ----  VD  --V  RE  G  EM  ----------------- V  HR  G  N  IIG  TV  G  LS  ------ G-  MT  -  NG  P  H  LHF  ELRK  ------  FGK  --------  PI  DP  IA  FL -------- 33
      34 -----------------------------------------  В  В  В  Г ---  I  D  Y  ----  G  ---  SP  -  K  G  S  --PV  Y  A  V  --------- ----------------  AA  ---------- G  VV  -----  TVS  G  YDDL  ----- -----  S  GN  K  I  AIR  ---  H  ----  R  D  N  -----  TESW  -YMHL -------  SVRG  V  N  VG  TK  ----------------- V  APR  Q  V  IG  RV  GST ------ G-  R  S - T  G  P  H  LH  L  --------------------------------- ---- 34
      35  LW  T  QPFVVPRPSRITS  G  F  G  S  G  RTFN  G  AVTS  -----------  R  H  M  G ---  T  D  Y  ----  A  ---  GA  -  V  G  A  --PV  R  A  V  ---------------- ---------  NR  ---------- G  VV  -----  RLVDAFYL  ---------- GGN  VVYID  - -  H  ----  GE  G -----  LVTA  -Y  L  HL-SK ----  QR  --V  AE  GD  T  ----- ------------ V  AR  GQIIG  NV  G  A  T ------ G-  RV  --T  G  P  H  LH  LITRF  --------------  GMVTV  DP  LSVI  -------- 35
      36  VSEPSL  S  LPVAGRFSSPF  G  LRR  Y  FN  G  EPRS  -----------  P  H  S  G ---  I  D  I  - ---  A  ---  AA  -  Q  GT - PV  V  A  A  ----------------------- -  AA  ---------- G  MV  ----- VE  V  G ----------  DYFFN  G  KTVFID  ---  H  ----  GH  G -----  LVTM  -Y  C  HL-  HE  ----  IH  --V  ST  G  QQ  ----- ------------ V  AREEV  IG  TV  G  R  T ------ G-  RA  --T  G  P  H  LH  WTVSLGDV  --------------  RVE  P  LL  FL -------- 36
      37  HLQGPFVKPLEGRITSAF  G  TRRQYGTLFTS  -----------  Y  H  E  G ---  L  DF ----  A  ---  AP  -  LK  T - PV  R  A  V  -------------------------  AK  ---------- G  RV  ----- V  LSERLRV  ----------  R  G  EAVI  L  A  ---  H  ----  GP  G-- ---  LCTG  -Y  W  HL-  AE  ----  RR  --V  R  VG  EE  ----------------- V  Q  AG  EV  IG  LL  GST ------ G-  L  S - T  G  P  H  LH  LEVRL  ----------- ---  FGVPV  DP  A  ----------- 37
      38 ------------------------------------------ H  T  G-- -  W  D  Y  ----  A  --- M  G  -  PPD  -  R  V  L  A  A  ----------- --------------  AP  ---------- G  QV  ----- V  F  AG  Y  S  DD  G  CATPA  ------  GAVIIE  ---  H  ----  GN  G -----  YRTL  -Y  W  HL-  AR  ----  VSVT  V - G  TM  ----------------- V  ER  G  AV  IG  IA  G  D  T ------ G-  CA  -  RGA   H  LH  L  Q  VQY  ------  LGRDVDPYGWCGT  DP  D  P  WALNPVGQI  - 38
      39 ------------------------------------------ H  G  G-- -  L  DF ----  R  ---  AP  -  L  GT - PV  H  A  A  ----------------- --------  VD  ---------- G  TV  -----  ILT  G ----  DHYF  ------  A  G  KS  I  YVD  ---  S  ----  GG  G-----V  ISV  -YMHL-S  R  ----  ID  --V  SA  G  ER  -----------------VKAGQ  A  I  AL  SGS  S  ------G-  RV  --T  G  P  H  LH  L  -------------------------------------  39
      40   LEGPFVWPVAGRLSSPFGFRRV  Y  NGVPRSH  ------------H  S  G---  I  D  I  ----  A  ---  VP  -  K  GT--PVKA  A  -------------------------  N  S----------G  RV  -----V  LT  G----  DFYL  ------  P  G  KIVIID  ---  H  ----  GL  G-----  IYTV  -Y  C  HL-  D  K----  IL  --VK  T  G  QA  -----------------V  DK  G  EK  I  AL  SG  AS  ------G-  RV  --T  G  P  H  LHF  GCY  ---  IEG  -  VKVDP  ----------------------  40
      41   WNGVFLKPNAGRMSTNYGVRRY  Y  NGTFAKD  --------  Y  --  Y  H  R  G---  L  D  Y  ----  A  ---  GA  -  A  G  S  --PV  I  A  P  -------------------------  AP  ----------G  RV  -----  ALV  G  RVSQ  G  FRI  ------  H  GN  VV  G  ID  ---  H  ----  GQ  G-----V  TSI  -  F  MHL-S  R  ----  I  N--VK  E  GD  L  -----------------VKAGQ  V  IG  AV  GST------G-  AA  --T  G  P  H  LH  WGLY  ---  VNG  -  QSVDPTPWRTKVVN  -------------  41
      42   SRLELSKPLNKLVVTSEF  G  EIRLIN  G  KRKS  -----------  V  H  R  G---VDF----  R  ---  AK  -  E  G  E  --  L  V  Y  AI-------------------------  MP  ----------GK  V  -----  RLT  G  NFFF  ----------  T  GN  TVIVE  ---  H  ----  GQ  G-----  LYSL  -Y  A  HL-S  E  ----  IL  --VK  E  G  QL  -----------------VKAG  EL  IG  RA  GST------G-  R  S--T  G  P  H  LH  LGLYL  ------  NGI  --------  PFN  P  LSL  L  RLR  -----  42
      43 -------------Y  ASAF  G  PRIH  P  VTGEI  G--------  K  --MH  Q  G---  I  D  I  ----  S  ---  ND  -  RW  T--P  IY  A  P  -------------------------  AD  ----------G  VV  -----  EISQL  S  SS  ----------  F  GN  FVV  L  N  ---  H  ----  GN  G-----  LKTR  -Y  G  H  M  -------  QMSA  V  TP  G  EF  -----------------V  HRY  QI  L  G  YM  G  N  T------G-  R  S--  VG  P  H  LH  YEVWK  ------  NGV  --------  PVN  P  L  P  YIL  -------  43
      44   DCSSFVMPVEDKQVTSQF  GY  RRR  -----  F  G--------  R  --MHYG---  I  D  L  ----  S  ---  V  N-  R  G  D  --  TIR  A  A  -------------------------  FD  ----------GK  V  -----  RVRSYEAR  G---------  Y  G  YY  I  V  L  R  ---  H  ----  PN  G-----  LETV  -Y  G  H  M  -S  R  ----  QL  --V  DENQI  -----------------V  R  AGQ  P  IG  LG  GST------G-  R  S--T  G  P  H  LHF  ETRF  ------  MGI  --------  PIN  P  NTIIDFDNGV  --  44
      45 ----------------------------  NTYGAERPGGR  --  K  H  E  G---  L  D  I  ----F---  AP  -  YFS  --  E  V  ISA  -------------------------S  D  ----------G  IV  -----  LKT  G  RDIL  G----------GN  V  I  RIL  --------  GID  -----  NRIYY  Y  A  HL-SK----Y  L  -  DF  K  TEYK  -----------------  I  K  Q  GQ  T  IG  YV  G  N  T------G-  NAVS  T  P  P  H  LHF  EI  -----------------------------------  45
      46 -----  IFPLKKFIVSSDF  G  FRND  P  FTG  N  KS  -----------  F  H  T  G---  I  D  L  ----  A  ---  AP  -  MNA  --  E  V  YSS  -------------------------SS----------G  IV  -----  I  EAG  YND  -  L  ---------  Y  GN  FVVVG  ---  H  ----  KNN  -----  IKSL  -Y  G  HL-  NL  ----Y  S  --VK  I  GD  F  -----------------VK  S  G  EFL  G  RV  G  Q  T------G-  RA  --T  G  P  H  LHF  EILK  ------  KNI  --------  PIN  P  L  -----------  46
      47 -----------  LERIPNVIPAVGIISKKFSYENK  --------H  L  G---  I  D  I  ----  S  ---  AR  -  K  G  N  --PV  F  A  S  -------------------------  G  S----------GK  V  -----  TF  AG  N  S  GD  ----------  L  GN  T  I  VID  ---  H  ----  QN  G-----  YKSS  -Y  S  HL-  KS  ----  IR  --  TRR  G  AN  -----------------V  TK  G  DV  IG  YV  G  D  T------G-  NT  --  SG  P  H  LH  YSITK  ------  NNLPQDPET  ------------------  47
      48 --------------------------------------  R  --  K  H  N  G---  I  D  V  ----  A  ---  SR  -  Q  G  A  --  RIL  A  P  -------------------------  YGAKAWTSRDER  G  GV  -----  II  A  LVRKQ  ------------  DV  I  LFM  ---  H  ----  C  D  K  -----  L  -----  LY  L-------------  N  G  QE  -----------------V  MP  G  DP  I  ATV  G  T  T------G-  HT  --T  G  P  H    A  H--------------------------------------  48
      49 ------------------------------------------H  N  G---  T  DF----  A  ---M  P  -IGT--PV  YTS  -------------------------  GD  ----------G  VV  -----V  MTRNHP  -------  Y  ---  A  GN  YVVIQ  ---  H  ----  GNT  -----  YMTR  -Y  L  HL-SK----  IL  --VK  K  G  QK  -----------------V  SR  GQ  R  IG  L  SG  N  T------G-  RV  --T  G  P  H  LH  YEL  -------------------------  IVR  -------  49
      50   GFLRFPT  A  KQFRISSNFNPRRTN  P  VTGRVA  --------  P  ---H  R  G---VDF----  A  ---M  P  -  Q  GT--PV  LSV  -------------------------  GD  ----------G  EV  -----V  V  A  KR  S  G  -------  A  ---  A  G  YYVAIR  ---  H  ----  GRS  -----  YTTR  -YMHL-  R  K----  IL  --VK  P  G  QK  -----------------VK  R  G  DR  I  AL  SG  N  T------G-  R  S--T  G  P  H  LH  YEV  -------------------------  WINQQAVNPL    50
      51   P  -----  LPATARLSSPFNPARLN  P  VSGKVS  --------  P  ---H  N  G---  I  D  Y  ----  S  ---M  P  -  MN  T--  KIVSV  -------------------------  ID  ----------GKI-----  TR  A  EYNS  -------  T  ---  M  G  YFVEVT  ---  G  ----  KA  G-----V  KTR  -Y  L  HL-  N  K----  IL  --V  TK  G  AR  -----------------V  TR  G  GA  I  AL  SG  NS  ------G-  R  S--  SG  P  H  LH  YEL  -------------------------  VINNNPVNSL    51
      52   P  -----  LPATARLSSPFNPARLN  P  VSGKVS  --------  P  ---H  N  G---  I  D  Y  ----  S  ---M  P  -  MN  T--  KIVSV  -------------------------  ID  ----------GKI-----  TR  A  EYNS  -------  T  ---  M  G  YFVEVT  ---  G  ----  KA  G-----V  KTR  -Y  L  HL-  N  K----  IL  --V  TK  G  AR  -----------------V  TR  G  GA  I  AL  SG  NS  ------G-  R  S--  SG  P  H  LH  YEL  -------------------------  VINNNPVNSL    52
      53 ------------------------------------------H  N  G---  I  D  Y  ----  S  ---M  P  -  MN  T--  KIVSV  -------------------------  IN  ----------GK  V  -----  TR  A  EYNS  -------  T  ---  M  G  YFVEVS  ---  G  ----  K  D  N  -----V  KTR  -Y  L  HL-SK----  IL  --VK  K  G  TP  -----------------V  SR  G  TA  I  AL  SG  NS  ------G-  R  S--  SG  P  H  LH  YEL  -------------------------  VINN  ------  53
      54 ------------------------------------------H  R  G---  I  D  I  ----  L  ---  IR  -  WD  T---V  RSA  -------------------------  TN  ----------G  SV  -----  YFV  G  YNPNDTIGGYEPNGA  GN  YVVIRSMYN  ----  GRL  -----V  YFY  -YMHL-  KQ  ----  PL  --V  A  V  N  D  V  -----------------V  LSS  Q  P  I  AI  SG  N  T------G-  R  S--T  GA    H  LHF  E  ------------------------------------  54
      55 ----  FIKPTDGYLSR  K  FDPENG  --------------------H  L  G---  I  DF----  A  ---  TK  -  ENN  --P  IF  A  S  -------------------------  AG  ----------G  Y  I-----  SF  AG  YTP  -------  E  ---  Y  G  YVVIVN  ---  H  ----  S  D  D  -----  FITR  -YMH  C  -S  V  ----  VV  --  R  K  Q  G  ER  -----------------V  IQ  G  EV  I  ALA  G  NS  ------G  TRT  --T  GT    H  LHF  EI  -------------------------  WH  K  GKPVDPE    55
      56 -  GNN  E  MVDYLGRRNVQYNS  -----------------------H  D  G---  H  D  Y  ----  VFPDAP  -  FS  T--P  IL  A  A  -------------------------  A  S----------G  TA  -----  YAFRE  S  R  ------------G  LGVVIV  ---  H  ----  PN  G-----  YETV  -Y  W  HL-S  AFAPIF  N--  EGN  G  VR  -----------------V  AT  GQ  Q  IG  V  SG  AS  ------G-  V  S--  GT  P  H  LHF  EVRRWEGGIRKQVDPYGWFGPGP  DP------------  56
      57 -----------------------------  RRTV  ---------H  L  G---VD  L  ----F---  AP  -  S  GT--PV  Y  A  P  -------------------------  LP  ----------G  MVVAVERFT  A  PLDF  ------------G  GMVV  L  E  ---  HQTPNG  D  H  -----  FYTL  -Y  G  HL-  D  -  PNSLDH  --  LH  VG  ES  -----------------  IA  AGQ  PFAAL  G  DA  ------  A  -  TNGGWQ  P  H  LH  L  Q  L  -----------------------------------  57
      58 ------  PLAQVA  N  VGLA  YG  WQIN  P  ATGEVF  -----------  F  H  S  G---VD  L  ----  L  ---  AP  -  V  G  S  --  N  V  L  AI-------------------------  AP  ----------G  TV  -----  AF  A  N  -  DQGS  ---------  Y  G  KLVIIN  ---  H  ----  SG  G-----  LQSR  -Y  AQ  L-  DS  ----  IK  --V  T  VG  QQ  -----------------VK  K  G  DLL  G  TV  G  TS  ------G-  KPTS  T  Q  P  H  LHF  EVRST  S  SLGWV  AQ----------DP  KGY  LK-------  58
      59 ------------------------------------------H  K  G---  T  DF----  A  ---  AK  -  A  GT--  AI  K  SL  -------------------------  Q  S----------GK  V  -----  QI  AG  Y  S  KT  ----------  A  GN  WVVIK  ---  Q  ----  D  DG-----  TVAK  -YMH  MLNT  ----  PS  --VK  T  G  QS  -----------------VKAGQ  T  IG  KV  GST------G-  N  S--T  GN    H  LH  L  Q  IEQ  ------  NGK  --------  TI  DP  EKYMQGI  G----  59
      60   M  A  NYSK  S  LSSATSSIAS  Y  YTNNSAFRVSSKYGQQESGLRSSP  H  K  G---  T  DF----  A  ---  AK  -  A  GT--  AI  K  SL  -------------------------  Q  S----------GK  V  -----  QI  AG  Y  S  KT  ----------  A  GN  WVVIK  ---  Q  ----  D  DG-----  TVAK  -YMH  MLNT  ----  PS  --VK  A  G  QS  -----------------VKAGQ  T  IG  KV  GST------G-  N  S--T  GN    H  LH  L  Q  IEQ  ------  NGK  --------  TI  DP  EKYMQGI  G  TSIS    60
      61 ------------------------------------------H  HA  ---  L  DF----  E  ---  CP  -  E  GT--P  ILSL  -------------------------  A  S----------G  TV  -----  K  E  VRQ  S  ETAGGVHARGLFHW  N  SVTVL  ---  Q  ----  E  DG-----  LLAE  -Y  V  H  I  -  LA  ----  GSAL  V  NP  GD  R  -----------------V  E  AGQ  PLCL  SG  GA  ------G-  FC  --  PT  P  H  LH  L  Q------------------------------------  61
      62 AA  QSN  HSA  S  WLNNYKKGYGYGPYPLGINGG-----------  N  HYG---VDF----F---MN-  V  GT--PV  R  AI-------------------------S  D  ----------GKI-----VEAGW  T  NYG---------GGN  E  IGL  V  ---E----NDG-----VHRQWYMHL-SK----  F  N--VKVGD  R  -----------------VKAGQIIGWSGST------G-YS--TAP  H  LHFQRM  T  NSFSN  N  TAQ----------DPMPFLKSAGYG  SN    62
      63   AATHEHSAQWLNNYKKGYGYGPYPLGINGG-----------MHYG---VDF----F---MN-IGT--PVKAI-------------------------SS----------GKI-----VEAGWSNYG---------GGNQIGLI---E----NDG-----VHRQWYMHL-SK----YN--VKVGDY-----------------VKAGQIIGWSGST------G-YS--TAP  H  LHFQRMVNSFSNSTAQ----------DPMPFLKSAGYGKA    63
      64 ------------------------------------------HYG---VD  Y  ----  A  ---M  P  -  ENS  --PV  YSL  -------------------------  TD  ----------G  TV  -----V  Q  AGWS  Y  YG---------GGNQ  VTIK  ---E----  ANS  -----  NNY  QWYMH  N  -  NR  ----  LT  --V  SA  GD  K  -----------------VKAG  DQ  I  AY  SGST------G-  N  S--TAP  H    V  HFQRM  SGGIG  N  QY  A  V  ----------DP  TSY  L  Q  S------  64
      65 ------------  FVLDMTTSIIPTESRRIAGHYGPRKHR  --MH  R  G---VD  L  ----  G  ---  LC  -  H  G  EDRTIV  A  A  -------------------------  FA  ----------GK  V  -----V  KVRNQGRRKG  -------  Y  G  RYVI  L  D  ---  H  ----  GN  G-----  LTTL  -Y  A  HL-------  ERWK  VKVGD  E  -----------------  LQ  AG  DT  IG  VG  G  NS  ------G-  R  S--  FGA    H  LH--  FEK  ------------  RYNGVYIN  P  ETVYDF  ------  65
      66 -----------------------------------------  I  H  E  G---  T  D  I  ----F---  AH  -  Y  G  L  --PVK  ST  -------------------------  CY  ----------G  VV  -----  EMK  GW  NRF  G----------G  WR  IG  IR  ---  D  ----  INN  -----  TYHY  -  FA  HL-  NG  ----  FAKGI  K  T  G  QI  -----------------V  EP  GQ  V  IG  SV  GS  S  -  GYGPP  G-  TAGKFP  P  H  LH  YGMYKDNGRTEWSF  ----------DP  Y  P  H  L  RA  ------  66
      67 -----------------------------------  GGRR  --  I  H  E  G---  T  D  I  ----F---  AH  -  Y  G  L  --PVK  ST  -------------------------  CY  ----------G  VV  -----  EMK  GW  NRF  G----------G  WR  IG  IR  ---  D  ----  INN  -----  TYHY  -  FA  HL-  NG  ----  FAKGI  K  T  G  QI  -----------------V  EP  GQ  V  IG  SV  GS  S  -  GYGPP  G-  TAGKFP  P  H  LH  YGMYKDNGRTEWSF  ----------DP  Y  P  H  L  RA  ------  67
      68 A  GRY  E  EGQ  Q  FG  N  TAFNRG  G  TY  --------------------  F  H  D  G---  F  DF----  G  ---  SAIY  G  NG  -  S  V  Y  A  V  -------------------------  HD  ----------GKI-----  LY  AGW  DPV  G  GGS  ------  L  G  AF  I  V  L  Q  --------  AGN  -----  TNVI  -Y  QEF  -S  RNVGDIK  --V  ST  G  QT  -----------------VK  K  GQ  L  IG  KF  ---------------T  SS    H  LH  LGMTKKEWRSAHSS  -  WNKDDGTWFN  P  I  P  I  L  QGGSTPTP    68
      69 -------------  LTRKALKDN  Y  TA  G  RAS  G--------  R  --  I  H  GA  ---  L  D  I  ----  A  ---  AP  -  RS  T--PV  L  A  A  -------------------------  AD  ----------  LV  I  G  ---  RLLT  G----  P  ---------  V  G  GIVIYA  ---  YDP  --  AEQ  -----  FTYY  -  FA  HL-  ER  ----Y  RRGLA  VGD  R  -----------------V  AK  G  SV  IG  YV  G  T  T------G-  NAPKN  AP  H  LHFQ  V  M  K  ------  RGTGRAWWDGPPIN  P  FSY  ---------  69
      70 ---------  LADVFTSPL  G  DENGAFTYVAQGVGDMNAARKGR  H  A  G---  Q  D  L  ----  NGIGGENTDEGL  PV  R  A  A  -------------------------  GR  ----------G  LL  -----  IY  AG  EPSPD  ---------  W  GN  VVV  L  L  ---  HRLPDGRF  -----V  QSL  -Y  A  HL--K----  TVSDIPL  G  TL  -----------------V  GR  G  EQ  IG  SV  G  TAH  -----G  N  Y  L  ----  A    H  LHF  EMIESIAHEAGMPGYGKTTFNRIN  P  DEV  LK  Q  ------  70
      71 ---------------  D  G  FDFPVGKPDG  NG  YYRSRGLRLKSPR  H  M  G---  E  D  W  ----  NGNKGGNSDLGD  PV  YSV  -------------------------  GH  ----------G  VV  -----  TY  A  ADARGA  ---------  W  G  KVVIVR  ---  HAFREPKSGKVLCCQTL  -Y  S  HL-  ND  ----  I  N--V  VL  G  QL  -----------------V  LR  G  TQV  G  TI  G  TNR  -----G  M  Y  P  ----  A    H  LH  VEL  -----------------------------------  71
      72 ------------------------------------  GLRPDQ  H  P  G---VD  INLQGTSGDAD  -  L  G  Y  --PV  V  A  V  -------------------------  AE  ----------G  RV  -----V  HSAFHRV  ----------  W  GN  VVLME  ---  HDLPGLGR  -----  FWT  Q-Y  A  HL-------  AHRAARE  GDY-----------------  LF  AG  EPV  G  SI  G  K  -------G  DPARPYLA    H  LHF  E  ------------------------------------  72
      73 ------------------------------  RIIQGYACG  --  T  H  N  G---  W  D  R  ----  Y  ---  SL  -  DLA  --  Q  V  HGP  --------------------------------------------  TYD  A  PIRAAASGTLWHWEARSGT  I  I  L  S  ---  H  ----  GNN  -----  FFTM  -Y  T  HL-S  RPVTTER  -----G  RF  -----------------  FAV  G  EVL  G  YA  G  DR  ------G-  SPG  --  I  P  H  LHF  TAFTAGANGWSGR  --------  QSI  P  LK  F  AEGY  -----  73
      74 ------------------------------------------H  T  G---  I  D  L  ----  L  ---  VE  -  K  G  D  --  QLV  A  P  -------------------------  FA  ----------G  S  I-----  TVDPTDSH  ------------  TV  I  IGS  ---E----  GGS  -----  LRGI  -  TVYI  -  TNIEPNSTIDTEE  G  RS  -----------------V  AS  GQ  P  IG  TV  --T------G-  SE  --  CDN    H    I  H  LAMFK  -------------  NGGTYI  DP  TKYIE  S  L  -----  74
      75 ------------------------------------------H  T  G---  L  D  L  ----  L  ---  AA  -  R  G  D  --  QLV  A  P  -------------------------  FA  ----------G  S  I-----  TVDPTDSH  ------------  TV  I  IGS  ---E----  GGS  -----  LRGI  -  TVYI  -  TNIEPLSIFDTEE  G  RS  -----------------V  A  AGQ  P  IG  TV  --T------G-  SD  --  CDN    H    I  H  LAMQK  -------------  DGGSYI  DP  TKYVE  S  I  -----  75
      76 ------------------------------------------H  K  G---VD  I  ----  S  ---  AE  -  K  G  D  --  MLV  A  P  -------------------------  FA  ----------G  S  I-----  TRDATDDE  ------------  AV  I  IT  I---  K  ----  TGS  -----  MAGM  -  IVYI  -  KNIEPNSTIETTTPST  -----------------  IA  AGQIIG  KV  --  V  ------  K  -  SP  --  CIN    H    I  H  MAMKK  ------------  QDAADYI  DP  TKY  L  E  S  I  -----  76
    
    
     
          Active site residue:             X   
          Metal binding site:            X 
          Putative:              + 
          Experimental:          # 

    Construction of a novel MK-4 biosynthetic pathway in Pichia pastoris through heterologous expression of Hs UBIAD1 | Microbial Cell Factories

    Strains and plasmids

    Escherichia coli DH5α cells used for plasmid propagation were preserved in our laboratory. P. pastoris GS115 (любезно предоставленный лабораторией передачи сигналов и транскрипции, Университет науки и технологий Китая, Хэфэй, Китай) использовали для конструирования штамма-продуцента MK-4. Векторы экспрессии pPICZA и pGAPZA были приобретены у YouBio (Хунань, Китай). Все штаммы и плазмиды, использованные в этом исследовании, перечислены в Дополнительном файле 1: Таблицы S1 и S2.

    Условия культивирования

    Escherichia coli инкубировали при 37 ° C в среде LB с низким содержанием соли, состоящей из 1% триптона, 0.5% дрожжевой экстракт и 0,5% NaCl. Среду YPD (2% триптона, 1% дрожжевого экстракта и 2% глюкозы) использовали для культивирования P. pastoris для дальнейшей подготовки компетентных клеток. Среда BMGY, используемая для активации рекомбинантного P. pastoris , состояла из 2% триптона, 1% дрожжевого экстракта, 1,34% среды дрожжевого азотного основания (YNB) без аминокислот, 1% глицерина, 4 × 10 -5 % биотина и 0,1 М фосфат калия (pH 6,0). Конститутивный рекомбинант P. pastoris с промотором P GAP инкубировали в течение примерно 24 ч при 30 ° C и 250 об / мин в 250-миллилитровых колбах, содержащих 25 мл среды BMGY.Для экспрессии белка, управляемой P AOX1 в P. pastoris , клетки собирали центрифугированием при 5000 × 95 · 109 g в течение 10 минут при комнатной температуре и ресуспендировали в среде BMMY (2% триптона, 1% дрожжевого экстракта. , 1,34% YNB, 4 × 10 -5 % биотина и 0,1 М фосфата калия (pH 6,0) и 0,3% метанола) до конечной плотности 1,0 при OD 600 , и метанол добавляли в среду BMMY до конечная концентрация 0,3% каждые 24 ч. Твердая среда была получена добавлением 2% агара к жидкой среде.Среду готовили стерилизацией при 121 ° C в течение 20 мин, а раствор глюкозы стерилизовали отдельно при 115 ° C в течение 15 мин. Кроме того, после стерилизации фильтрацией отдельно добавляли основной раствор 10 × YNB и 500 × биотина.

    Биоинформатический анализ

    Hs UBIAD1

    SOPMA (https://npsa-prabi. ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_sopma.html) был применен для предсказания вторичной структуры 9 Hs. UBIAD1 из аминокислотной последовательности, в частности, для предсказания скорости вторичных структурных элементов [39].Поскольку гидрофобность аминокислотной последовательности предсказывает укладку белка, мы проанализировали гидрофобность Hs UBIAD1 с использованием нескольких инструментов, включая SOSUI, ProtScale и DNAMAN. SignalP 3.0 (http://www.cbs.dtu.dk/services/SignalP-3.0/) обычно используется для прогнозирования присутствия и местоположения сигнального пептида, а также для распознавания сигнального пептида Hs UBIAD1 [ 40]. WoLF PSORT (https://wolfpsort.hgc.jp/) использовали для предсказания субклеточного местоположения Hs UBIAD1 на основе программы PSORT II [41].Трансмембранная топология Hs UBIAD1 была предсказана с использованием ряда предикторов трансмембранной топологии, таких как Phobius, OCTOPUS и TMHMM. Программное обеспечение для онлайн-анализа Protter было использовано для визуализации трансмембранной топологии Hs UBIAD1. SWISS-MODEL, сервер автоматического моделирования гомологии белков, был использован для предсказания третичной структуры Hs UBIAD1 на основе его аминокислотной последовательности.

    Гомологичные последовательности Hs UBIAD1, полученные из базы данных Национального центра биотехнологической информации (NCBI), выравнивали с помощью Clustal X.Затем был проведен филогенетический анализ с помощью программы MEGA X. История эволюции была выведена с использованием метода объединения соседей, основанного на модели Пуассона, и бутстрап-анализ проводился с 1000 повторениями. Филогенетическое дерево было отредактировано EvolView. Выравнивание множественных последовательностей Ap UbiA, At PPT1, Ec UbiA, Le PGT-1, Os PPT, Sc CoQ 2 , Bl MenA, Ec 10 MenA Kp MenA, Pa UBIAD1, Pt UBIAD1 и Hs UBIAD1 были выполнены с использованием Clustal X, а затем проанализированы с помощью ESPript 3. 0.

    Конструирование вектора экспрессии

    Кодон гена Hs UBIAD1, который был искусственно синтезирован General Biosystems, Inc. (Аньхой, Китай), был оптимизирован на основе предпочтения кодонов для достижения высоких уровней экспрессии белка. в P. pastoris . Содержимое CAI и GC оптимизированной последовательности было проанализировано веб-сервером GenScript (http://www.genscript.com). Ген Hs UBIAD1 амплифицировали с использованием праймеров UBIAD1-F-EcoRI и UBIAD1-R-NotI, перечисленных в Дополнительном файле 1: Таблица S3, которые содержат полноразмерный UBIAD1.Продукты ПЦР расщепляли Eco RI и Not I и вставляли между Eco RI и Not I сайтами pGAPZA, где Hs UBIAD1 находится под контролем конститутивного промотора P GAP на вектор, и полученная плазмида была названа pGU. Описанный выше фрагмент Hs UBIAD1 был клонирован во множественные сайты клонирования pPICZA, которые, таким образом, генерировали pPU. В рекомбинантном векторе pPU белок Hs UBIAD1 контролировался P AOX1 .Рекомбинантные плазмиды, выращенные на чашках с агаром LB с низким содержанием соли и 50 мкг / мл зеоцина, секвенировали после ПЦР колоний для подтверждения присутствия и ориентации вставки.

    Для получения стабильных мультикопийных интегрантов в P. pastoris мы попытались сконструировать вектор мультикопийной экспрессии путем интеграции нуклеотидной последовательности части 28S рибосомной ДНК (рДНК), амплифицированной из P. pastoris , в вектор экспрессии pGAPZA. Конкретно, фрагмент рДНК был амплифицирован из геномной ДНК P.pastoris GS115 с использованием праймеров рДНК-F и рДНК-R, перечисленных в Дополнительном файле 1: Таблица S3, и клонированных в сайт Bam HI pGAPZA для получения желаемого вектора экспрессии pGAPZA-рДНК. Ген геранилгеранилпирофосфатсинтазы ( ggpps ) из Sulfolobus acidocaldarius , использованный в данном исследовании, был искусственно синтезирован General Biosystems, Inc. (Аньхой, Китай). Кодирующая область ggpps была амплифицирована с помощью ПЦР с использованием праймеров GGPPS-F-EcoRI и GGPPS-R-NotI, перечисленных в Дополнительном файле 1: Таблица S3, и клонирована в вектор экспрессии pGAPZA-rDNA с использованием тех же методов, таким образом создавая pGrG .Впоследствии кассеты экспрессии Sa GGPPS были интегрированы в локус рДНК путем гомологичной рекомбинации.

    Ген изомеразы IPP ( idi ) был амплифицирован с помощью ПЦР из геномной ДНК P. pastoris GS115 с использованием праймеров IDI-F-EcoRI и IDI-R (дополнительный файл 1: Таблица S3), а ggpps Фрагмент ПЦР амплифицировали из плазмиды pGrG с помощью праймеров GGPPS-F и GGPPS-R- Not I, перечисленных в Дополнительном файле 1: Таблица S3. Слитый ген idi ggpps был сконструирован путем слияния гена ggpps с 3′-концом гена idi следующим образом, и гибкий линкер (GGGGS) 2 последовательность GGTGGCGGTGGGTCGGGC была вставлена ​​между idi и ggpps гены. Эти два фрагмента были очищены отдельно, а затем слиты с помощью ПЦР с перекрывающимся удлинением с использованием пары праймеров IDI-F- Eco RI и GGPPS-R- Not I (дополнительный файл 1: таблица S3), которые содержали EcoRI на 5 ′ -Конец и NotI на 3′-конце. Слитый ген idi ggpps расщепляли Eco RI и Not I и клонировали в сайты многоклонирования pGAPZA-рДНК, как описано ранее, и затем конструировали соответствующую плазмиду pGrIG.

    Трансформация и скрининг рекомбинантного

    Hs UBIAD1-продуцирующего P. pastoris

    Электрокомпетентные клетки P. pastoris GS115 получали в соответствии со следующим протоколом. Единственную колонию P. pastoris выращивали в колбах на 250 мл, содержащих 25 мл среды YPD, и инкубировали при 30 ° C и 250 об / мин в течение ночи (16–18 ч). 50 мл свежей среды YPD инокулировали в колбу на 250 мл с 0,5 мл ночной культуры до достижения OD 600 , равного 1. 1–1.3. Культуру центрифугировали при 1500 × 95 · 109 g в течение 5 мин при 4 ° C, затем клетки суспендировали в 20 мл ледяной стерильной воды. Клетки центрифугировали при 1500 × 95 · 109 g в течение 5 минут при 0 ° C, затем повторно суспендировали осадок в 20 мл ледяной стерильной воды, повторно. После трех центрифугирования осадок ресуспендировали в 5 мл ледяного 1 М сорбита. После повторного центрифугирования при 1500 × 95 · 109 g в течение 5 мин при 0 ° C клетки окончательно суспендировали в 0,2 мл ледяного 1 M сорбита.

    Рекомбинантные векторы pGU и pPU были линеаризованы рестрикционными ферментами Bsp HI и Sac I по отдельности, затем электропорация была проведена в обезвреженный P. pastoris GS115 с помощью электропорации. Трансформанты отбирали на планшетах с дефицитом гистидина MD (1,34% YNB, 4 × 10 -5 % биотина, 2% глюкозы и 2% агара), содержащих зеоцин (100 мкг / мл), и наличие кассеты экспрессии было подтверждено. ПЦР колоний с использованием пар праймеров pGAP-F / 3’AOX1 и 5’AOX1 / 3’AOX1, перечисленных в Дополнительном файле 1: Таблица S3. После первоначального отбора для отбора многокопийных трансформантов использовали диапазон концентраций (200, 400, 500, 1000 мкг / мл) зеоцина.

    Экспрессия рекомбинантного

    Hs UBIAD1

    Колонию, положительную по GGU и GPU, культивировали в течение 24 ч при 30 ° C и 250 об / мин в пробирке 18 × 180 мм, содержащей 5 мл среды BMGY для экспрессии. рекомбинантного Hs UBIAD1. После 24 часов культивирования активированные клетки GPU собирали и ресуспендировали в 5 мл среды BMMY в той же пробирке для индукционной ферментации при 22 ° C в течение 48 часов с добавлением 2% метанола каждые 24 часа.Внутриклеточные белки рекомбинантного P. pastoris экстрагировали с использованием набора для экстракции общего белка дрожжей (Sangon Biotech, Шанхай, Китай). Затем уровни экспрессии рекомбинантного Hs UBIAD1 определяли с помощью дот-блоттинга для скрининга штаммов, продуцирующих Hs UBIAD1 с высоким выходом.

    Для получения оптимальных условий экспрессии в P. pastoris GS115 температура культивирования составляла от 20 до 30 ° C, а начальные значения pH составляли от 4 до 9.Рекомбинантный P. pastoris выращивали при 250 об / мин в 250-мл колбах, содержащих 50 мл среды BMGY, и образцы отбирали каждые 12 ч во время ферментации. После завершения культивирования образцы центрифугировали при 13000 × 95 · 109 g в течение 5 минут при 4 ° C, затем рекомбинантный Hs UBIAD1 экстрагировали из влажной клеточной массы с использованием набора для экстракции общего белка дрожжей. Затем уровни экспрессии определяли с помощью вестерн-блоттинга, и ImageJ использовали для обработки и анализа результатов с β-актином в качестве эталона.В то же время, другая часть влажных клеток после центрифугирования сушилась в вакуумной сублимационной сушилке в течение 6–8 ч, а биомасса рекомбинантного GGU-23 определялась путем измерения массы сухих клеток (DCW). Все указанные значения представляют собой средние значения трех испытаний (± стандартная ошибка).

    Вестерн-блоттинг, обнаружение

    Hs UBIAD1

    Образцы смешивали с 5-кратным буфером для загрузки образцов SDS-PAGE и кипятили в течение 5 мин. Полосы белка разделяли с помощью SDS-PAGE с 12% разделяющим гелем и 5% стекирующим гелем и переносили на нитроцеллюлозные мембраны (Beyotime, Шанхай, Китай).Мембраны инкубировали с 5% обезжиренным сухим молоком в TBS с 0,1% Tween-20 (TBST) для блокирования, а затем инкубировали с 6-кратным His-tag мышиным моноклональным антителом (разведение 1: 2500, EnoGene Biotech, Нанкин, Китай). После промывки TBST мембраны инкубировали с подходящими конъюгированными с пероксидазой хрена (HRP) козьими антимышиными IgG (разведение 1: 5000, EnoGene Biotech, Нанкин, Китай). Наконец, иммунореактивные белки были обнаружены с помощью BeyoECL Star (Beyotime, Шанхай, Китай).

    Очистка рекомбинантного

    Hs UBIAD1

    Внутриклеточные белки, экстрагированные ранее, концентрировали и подвергали последующей очистке с использованием Ni – NTA аффинной хроматографии. Неочищенный раствор фермента очищали с помощью набора для смолы Ni – NTA Sefinose ™ (BBI, UK) в соответствии со спецификациями производителя. Затем элюент пропускали через гравитационную колонку для обессоливания (BBI, Великобритания) для удаления солей. Очищенные белки Hs UBIAD1 замораживали и хранили при -80 ° C для подготовки к последующим экспериментам.

    Ферментативный анализ

    Hs UBIAD1

    Ферментативную реакцию на Hs UBIAD1 проводили in vitro, и условия корректировали в соответствии с методом Hirota et al.[1]. Первоначально реакции проводили в 1 мл 100 мМ Трис-HCl (pH 8,0), содержащего 1 мМ DTT, 10 мкМ GGPP, 10 мкМ VK 1 или VK 3 и 10 мг белка Hs UBIAD1. Реакционные смеси инкубировали при 37 ° C в течение 1 ч, затем останавливали добавлением 1 мл метанола, и органическую фазу использовали для анализа ВЭЖХ. Активность Hs UBIAD1 измеряли при различных значениях pH и температуры в присутствии различных ионов металлов, а начальную активность Hs UBIAD1 измеряли без ионов металлов при pH 8. 0 и 37 ° С. Приведенные значения относительной активности представляют собой средние значения трех испытаний.

    Кроме того, мы проанализировали условия ферментативной реакции Hs UBIAD1 in vivo с использованием цельноклеточной каталитической системы. После 36 часов ферментации к каталитической смеси добавляли VK 3 (10 мг / л, в метаноле) и MgCl 2 (10 мМ), которую инкубировали при 31 ° C для проведения последующей каталитической реакции. Впоследствии каталитические продукты были извлечены и обнаружены.

    Трансформация и скрининг высокопродуктивного МК-4, продуцирующего

    P. pastoris

    Рекомбинантные плазмиды pGrG и pGrIG были линеаризованы рестрикционным ферментом SpeI для интеграции в локус рДНК и электропорированы в электрокомпетентные клетки высокопродуктивного штамма GGU-23 для генерации GGU-GrG и GGU-GrIG, соответственно. . Трансформанты отбирали на чашках с MD-агаром с дефицитом гистидина, содержащими 500 мкг / мл зеоцина. Затем быстро выполняли ПЦР-анализ колоний для идентификации присутствия экспрессионной кассеты с использованием пар праймеров pGAP-F / 3’AOX1, перечисленных в Дополнительном файле 1: Таблица S3.Для скрининга высокопродуктивного MK-4, продуцирующего P. pastoris , положительные трансформанты GGU-GrG и GGU-GrIG были инокулированы и впоследствии обработаны, как описано ранее.

    Экстракция и анализ MK-4

    Для экстракции определенного количества MK-4, используемого для анализа, рекомбинантный P. pastoris культивировали в соответствии с предыдущим методом. После ферментации и цельноклеточного катализа 25 мл ферментированного бульона центрифугировали при 13000 × 95 · 109 g в течение 5 минут при 4 ° C и сушили в вакуумной сублимационной сушилке в течение 6–8 часов.Биомассу каждого рекомбинанта определяли путем взвешивания лиофилизированной клеточной массы, затем добавляли метанол (5 мл) с последующей статической экстракцией в течение 2 часов. Затем к супернатантам добавляли н-бутиловый спирт (5 мл) и смесь для экстракции перемешивали в течение 2 часов при 150 об / мин. Органическую фазу центрифугировали при 13000 × 95 · 109 g в течение 10 мин и фильтровали через органические мембраны с порами 0,45 мкм. Как внутриклеточные, так и внеклеточные уровни MK-4 анализировали с помощью высокоэффективной жидкостной хроматографии (ВЭЖХ).Метанол и дихлорметан были выбраны в качестве подвижной фазы в соотношении 4: 1 (об. / Об.). Детектор работал на длине волны 248 нм для количественного обнаружения МК-4, при которой менахиноны проявляли сильное УФ-поглощение. Содержание МК-4 рассчитывали по площадям пиков на основе стандартных кривых МК-4. Затем пренилированные продукты анализировали с использованием системы жидкостной хроматографии и масс-спектрометрии (ЖХ – МС), оснащенной анализатором ETD LTQ Orbitrap XL (Thermo Fisher Scientific, США).

    IDI ELECTRONICA для ПК / Mac / Windows 7.8.10 — Скачать бесплатно

    Разработано: ROJAS BARNETT JORGE LUIS

    Лицензия: БЕСПЛАТНО

    Рейтинг: 0/5 — голосов

    Последнее обновление: 2 ноября 2017 г.

    Сведения о приложении

    Версия 1,0
    Размер 10M
    Дата выпуска 2 ноября 2017
    Категория Социальные приложения

    Что нового:
    IDI… [подробнее]

    Описание:
    IDI ELECTRÓNICA ® Empresa de desarrollo, Capacitación en … [читать дальше]


    Ищете способ загрузить IDI ELECTRONICA для Windows 10/8/7 PC ? Значит, вы в правильном месте. Продолжайте читать эту статью, чтобы узнать, как загрузить и установить одно из лучших социальных приложений IDI ELECTRONICA для ПК.

    Большинство приложений, доступных в магазине Google Play или iOS Appstore, созданы исключительно для мобильных платформ.Но знаете ли вы, что по-прежнему можете использовать любое из ваших любимых приложений для Android или iOS на своем ноутбуке, даже если официальная версия для платформы ПК недоступна? Да, они выходят из нескольких простых приемов, которые вы можете использовать для установки приложений Android на машину Windows и использования их, как вы используете на смартфонах Android.

    В этой статье мы перечислим различные способы Загрузить IDI ELECTRONICA на ПК в виде пошагового руководства. Итак, прежде чем приступить к делу, давайте посмотрим на технические характеристики IDI ELECTRONICA.

    IDI ELECTRONICA для ПК — Технические характеристики

    Имя IDI ELECTRONICA
    Установки 10+
    Разработано ROJAS BARNETT JORGE LUIS

    3 в списке 950Is Social в списке 950I категория приложений в Google Playstore. У него действительно хорошие рейтинги и отзывы. В настоящее время IDI ELECTRONICA для Windows получил более установок 10+ приложений, и 0 звезд средний совокупный рейтинг пользователей.

    IDI ELECTRONICA Скачать для ПК Windows 10/8/7 Ноутбук:

    Большинство приложений в наши дни разрабатываются только для мобильной платформы. Игры и приложения, такие как PUBG, Subway surfers, Snapseed, Beauty Plus и т. Д., Доступны только для платформ Android и iOS. Но эмуляторы Android позволяют нам использовать все эти приложения и на ПК.

    Таким образом, даже если официальная версия IDI ELECTRONICA для ПК недоступна, вы все равно можете использовать ее с помощью эмуляторов. В этой статье мы представим вам два популярных эмулятора Android для использования IDI ELECTRONICA на ПК .

    IDI ELECTRONICA Загрузить для ПК Windows 10/8/7 — Метод 1:

    Bluestacks — один из самых крутых и широко используемых эмуляторов для запуска приложений Android на вашем ПК с Windows. Программное обеспечение Bluestacks доступно даже для Mac OS. Мы собираемся использовать Bluestacks в этом методе для загрузки и установки IDI ELECTRONICA для ПК с Windows 10/8/7 Laptop . Начнем с пошагового руководства по установке.

    • Шаг 1 : Загрузите программное обеспечение Bluestacks по приведенной ниже ссылке, если вы не устанавливали его ранее — Загрузите Bluestacks для ПК
    • Шаг 2 : Процедура установки довольно проста и понятна. После успешной установки откройте эмулятор Bluestacks.
    • Шаг 3 : Первоначальная загрузка приложения Bluestacks может занять некоторое время. После его открытия вы должны увидеть главный экран Bluestacks.
    • Шаг 4 : Магазин Google Play предустановлен в Bluestacks. На главном экране найдите Playstore и дважды щелкните значок, чтобы открыть его.
    • Шаг 5 : Теперь найдите приложение, которое хотите установить на свой компьютер. В нашем случае найдите IDI ELECTRONICA для установки на ПК.
    • Шаг 6 : После нажатия кнопки «Установить» IDI ELECTRONICA будет автоматически установлена ​​на Bluestacks. Вы можете найти приложение в списке установленных приложений в Bluestacks.

    Теперь вы можете просто дважды щелкнуть значок приложения в bluestacks и начать использовать приложение IDI ELECTRONICA на своем ноутбуке. Вы можете использовать приложение так же, как на смартфонах Android или iOS.

    Если у вас есть APK-файл, то в Bluestacks есть возможность импортировать APK-файл.Вам не нужно заходить в магазин Google Play и устанавливать игру. Однако рекомендуется использовать стандартный метод для установки любых приложений Android.

    Последняя версия Bluestacks обладает множеством потрясающих функций. Bluestacks4 буквально в 6 раз быстрее смартфона Samsung Galaxy J7. Поэтому использование Bluestacks — это рекомендуемый способ установки IDI ELECTRONICA на ПК. Для использования Bluestacks у вас должен быть компьютер минимальной конфигурации. В противном случае вы можете столкнуться с проблемами загрузки во время игры в высококачественные игры, такие как PUBG.

    IDI ELECTRONICA Загрузить для ПК Windows 10/8/7 — Метод 2:

    Еще один популярный эмулятор Android, который в последнее время привлекает большое внимание, — это MEmu play.Он очень гибкий, быстрый и предназначен исключительно для игровых целей. Теперь посмотрим, как Скачать IDI ELECTRONICA для ПК с Windows 10 или 8 или 7 ноутбука с помощью MemuPlay.

    • Шаг 1 : Загрузите и установите MemuPlay на свой компьютер. Вот ссылка для скачивания — веб-сайт Memu Play. Откройте официальный сайт и скачайте программу.
    • Шаг 2 : После установки эмулятора просто откройте его и найдите значок приложения Google Playstore на главном экране Memuplay.Просто дважды нажмите на нее, чтобы открыть.
    • Шаг 3 : Теперь выполните поиск приложения IDI ELECTRONICA в магазине Google Play. Найдите официальное приложение от разработчика ROJAS BARNETT JORGE LUIS и нажмите кнопку «Установить».
    • Шаг 4 : После успешной установки вы можете найти IDI ELECTRONICA на главном экране MEmu Play.

    MemuPlay — это простое и удобное приложение. Он очень легкий по сравнению с Bluestacks. Поскольку он разработан для игровых целей, вы можете играть в высококлассные игры, такие как PUBG, Mini Militia, Temple Run и т. Д.

    IDI ELECTRONICA для ПК — Вывод:

    IDI ELECTRONICA приобрела огромную популярность благодаря простому, но эффективному интерфейсу. Мы перечислили два лучших метода для установки IDI ELECTRONICA на ПК с Windows, ноутбук . Оба упомянутых эмулятора популярны для использования приложений на ПК. Вы можете использовать любой из этих методов, чтобы получить IDI ELECTRONICA для ПК с Windows 10 .

    Мы завершаем эту статью о IDI ELECTRONICA Download for PC с этим.Если у вас есть какие-либо вопросы или проблемы при установке эмуляторов или IDI ELECTRONICA для Windows , сообщите нам об этом в комментариях. Будем рады Вам помочь!

    HB-IDI | Дуглас DC-8-62 | Swissair | Герхард Пломитцер

    Если вы ищете фотографии конкретного типа самолета, воспользуйтесь этим меню.
    Обратите внимание, что из-за нехватки места это меню включает только некоторые из наиболее востребованных самолетов в нашей базе данных. Если самолет, который вы ищете, отсутствует в этом списке, используйте поле «Ключевые слова» ниже в меню поиска.

    Некоторые пункты меню включают общую модель самолета, а также более конкретные варианты этого авиалайнера. Эти варианты обозначаются знаком — перед названием самолета.

    Например, если выбрать «Boeing 747», отобразятся результаты со всеми самолетами Boeing 747 в нашей базе данных, а при выборе «- Boeing 747-200» будут показаны все варианты Boeing 747-200 в нашей базе данных (Boeing 747-200, Boeing 747- 212B, Boeing 747-283F и др.)

    Если вы ищете фотографии конкретной авиакомпании, воспользуйтесь этим меню.

    Обратите внимание, что из-за нехватки места в это меню включены только авиакомпании, 10 или более фотографий которых есть в нашей базе данных. Если искомой авиакомпании нет в этом списке, используйте поле «Ключевые слова» ниже в меню поиска.

    Авиакомпании перечислены в алфавитном порядке.

    Если вы ищете фотографии, сделанные в определенной стране или в конкретном аэропорту, используйте это меню.

    Все страны, представленные в нашей базе данных, включены в это меню выбора, которое автоматически обновляется по мере роста базы данных. Прежде чем этот аэропорт будет добавлен в этот список, в базе данных должно быть не менее 20 фотографий из определенного аэропорта.

    Используйте эту опцию, чтобы включить в поиск только фотографии, сделанные определенным фотографом.

    В этом раскрывающемся меню, помимо каждого фотографа, доступного в качестве ограничителя поиска, также отображается количество фотографий в базе данных для каждого конкретного фотографа, заключенное в скобки. Например, вариант:
    — Пол Джонс [550]
    . . означает, что в настоящее время в базе данных содержится 550 фотографий, сделанных Полом Джонсом.

    Примечание. Общее количество фотографий, заключенных в скобки, обновляется четыре (4) раза в час и может быть немного неточным.

    Фотографы должны иметь 100 или более фотографий в базе данных, прежде чем их имя будет включено в это меню выбора.
    Выбор «Все фотографы» является выбором по умолчанию для этого параметра.

    Если вы ищете определенную категорию фотографий, используйте это меню.

    Вы можете выбрать отображение только фотографий из определенных категорий, таких как «Специальные схемы окраски», «Фотографии с полетной палубы» и т. Д.К этому списку постоянно добавляются новые категории.

    Поле «Ключевые слова», пожалуй, самое полезное поле в нашей поисковой системе.
    Используя это поле, вы можете искать любое слово, термин или их комбинации в нашей базе данных.
    Каждое поле с фотографией покрывается программой поиска по ключевым словам.

    Поле Ключевые слова идеально подходит для поиска такой специфики, как регистрация самолетов, имена фотографов, названия конкретных аэропортов / городов, конкретные схемы окраски (т.е. «Wunala Dreaming») и т. Д.
    Чтобы использовать поле «Ключевые слова», сначала выберите поле поиска «Мир ключей». Вы можете выбрать либо конкретное поле базы данных (авиакомпания, самолет и т. Д.), Либо выбрать соответствие ключевого слова всем полям базы данных.

    Затем выберите ограничитель ключевых слов. Вы можете выбрать один из трех вариантов:
    — это точно
    — начинается с
    — содержит
    . Выберите соответствующий ограничитель для вашего поиска, затем введите ключевое слово (а), которые вы хотите найти, в поле справа.

    В поле поиска по ключевым словам регистр не учитывается.

    Используйте эту опцию, чтобы включить в поиск только фотографии, сделанные в определенный год.

    В этом раскрывающемся меню, помимо каждого года, доступного в качестве ограничителя поиска, также отображается количество фотографий в базе данных для каждого конкретного года, заключенное в скобки. Например, вариант:
    — 2003 [55000]
    .. указывает, что в настоящее время в базе данных содержится 55 000 фотографий, сделанных в 2003 году.
    * Примечание. Общее количество фотографий, заключенных в скобки, обновляется четыре (4) раза в час и может быть немного неточным.

    Кроме того, в этом меню доступны диапазоны декад (1990–1999 и т. Д.). При выборе диапазона десятилетий будут отображаться все фотографии, соответствующие другим критериям поиска, из выбранного десятилетия.
    Выбор «Все годы» является выбором по умолчанию для этого параметра.

    Бангладеш опережает 40 стран по индексу IDI МВФ

    Бангладеш продемонстрировала стабильное и качественное улучшение основных экономических показателей в прошлом году, занимая лидирующие позиции в Индексе инклюзивного развития (IDI) Международного валютного фонда (МВФ). Среди 74 стран с развивающейся экономикой страна в этом году заняла 34-е место в годовом индексе МВФ, который отражает качество экономических показателей в конкретной стране. В этом индексе Бангладеш также показал намного лучшие результаты, чем Индия (62 место), Пакистан (52 место) и Шри-Ланка (40 место).В индекс также включены 29 развитых стран, во главе с Норвегией. Исландия, Люксембург, Швейцария и Дания последовали за скандинавским государством на вершине рейтинга, а Греция, Португалия, Италия, Испания и Израиль оказались в пятерке последних. Литва возглавила рейтинг стран с развивающейся экономикой, за ней следуют Венгрия, Азербайджан, Латвия и Польша. Мозамбик, Лесото, Малави, Зимбабве и Египет вошли в пятерку худших. По сравнению с прошлым годом, Бангладеш поднялся на две ступени до 34-го по сравнению с предыдущей 36-й позицией, сохранив общую оценку около 4 по шкале 1-7, где 1 означает худшее, а 7 — лучшее.IDI — это ежегодная оценка экономических показателей 103 стран, которая измеряет, как страны работают по одиннадцати измерениям экономического прогресса в дополнение к ВВП. Это занятость, производительность труда, доход домохозяйства, доход на душу населения, чистые сбережения, ожидаемая продолжительность жизни, уровень бедности, распределение богатства, государственный долг и экологические инициативы. IDI был разработан для измерения устойчивого и всеобъемлющего экономического прогресса стран и рекомендует будущую стратегию устранения финансовых проблем, с которыми оцениваемые страны столкнутся или столкнутся в ближайшие годы.По данным IDI, Бангладеш входит в число 20% лидеров по улучшению сбережений и распределения благосостояния, в то время как по другим 10 показателям страна находится в середине из 103 стран. Согласно Бангладешскому бюро статистики (BBS), Бангладеш добился 7,28% роста ВВП в прошлом финансовом году, когда правительство повысило целевой бюджетный показатель до 7,4% на текущий 2017-18 (FY18). Доход на душу населения также вырос до 1610 долларов в 2016-2017 финансовом году, когда инфляция была стабильной на уровне 5%.

    Рабочих листов бесплатного финансирования

    Explode The Code ® Online Now на вашем iPad или любимом планшетном устройстве. Мы рады сообщить, что теперь вы можете получить доступ к программе из браузера на своем мобильном устройстве с сенсорным экраном! Рабочие листы и задания для печати по акустике (семейства Word). © Предоставлено Линн Гюнтер. Существуют разные мнения о том, полезно ли использование фонетики в обучении детей чтению. Бесплатные рабочие листы по английскому языку. Загружаемые рабочие листы для учителей ESL / ESOL / EFL. Бесплатные рабочие листы по английскому языку. Рабочие листы из Больших Книг. Бесплатные распечатанные рабочие листы по грамматике, лексика, орфография, музыка и другие классные распечатки. Есть письменные практические листы, поиск слов, настольные игры, бесплатные упражнения на письмо, чтение…Рабочие листы для чтения во втором классе содержат вопросы на понимание, которые бросят вызов учащимся на начальном уровне чтения. Наши рабочие листы для чтения во втором классе можно использовать для разных уровней обучения. Наши рабочие листы для чтения во втором классе можно бесплатно загрузить и легко получить в формате PDF. Более 2000 страниц БЕСПЛАТНЫХ алфавитных распечаток, включая веселые игры, рабочие листы без подготовки, рукописные страницы, раскраски ABC, вырезки и вставки листов и многое другое !! Вот наши 6 самых популярных алфавитных постов: 26 поделок с алфавитом от A до Z — супер-милая поделка для детей, которую дети могут сделать для каждой буквы алфавита

    Каждый бесплатный рабочий лист по фонетике также включает в себя расширение урока — дополнительные занятия, которые помогут ученикам освоить определенные преподаваемые навыки на рабочем листе или просмотрите уже изученный материал.Вы также найдете учебное руководство с советами по использованию акустики максимально эффективно, а также сборник часто задаваемых вопросов. Префиксы Рабочие листы Префиксы Рабочие листы, Идентификация префиксов Рабочие листы Стандартные основные государственные стандарты: 2.L.4.b Определяет значение нового слова, образованного при добавлении известного префикса к известному слову; 2.RFS.3.d Расшифровать слова с общими префиксами и суффиксами. Вот несколько страниц для проверки правописания и практики. Тесты на правописание составляют от 10 до 50 слов.Наведите указатель мыши на изображение, чтобы увидеть, как выглядит PDF-файл. Затем вы можете щелкнуть любое изображение, чтобы открыть PDF-файл. Затем вы можете распечатать PDF-файл. Бумага для проверки орфографии — проверка орфографии… Бумага для проверки орфографии Подробнее »

    Рабочие листы Fundations — все 8 печатных форм. Рабочие листы — это сетка для письма Уилсона. Найдя свой рабочий лист, щелкните всплывающий значок или значок печати, чтобы распечатать или загрузить рабочий лист. 17 февраля 2019 г. · Рабочие листы Spring для дошкольников. Этот бесплатный пакет в формате pdf содержит девять страниц для печати с веселыми весенними рабочими листами для дошкольников.Они охватывают все основы дошкольного обучения — числа, буквы, формы, мелкую моторику и дополнительные математические задачи. Ваши дети будут работать над: распознаванием чисел 1-10 Рабочие листы на английском языке для печати. Бесплатно загружаемые рабочие листы в формате PDF для учителей Распечатайте больше рабочих листов! 1. Выполните поиск упражнений в строке поиска вверху 2. Перейдите на страницу 3. Используйте значок принтера … Отображение первых 8 рабочих листов, найденных для — Уровень финансирования 1. Некоторые из рабочих листов для этой концепции — это дом государственных школ округа Вашингтон, обзор программы Fundations Уровень 1, Фонды в классах k 1 2, Второе издание, уровень 1 хитрых слов, всего слов 93, Второе издание, уровень k, всего слов, 27, Рассказ уровня 2, Информационный пакет о фондах первого класса для родителей…

    Fundations дает детям с разными способностями обучения основы чтения и правописания. Мультисенсорная языковая программа с постукиванием по доскам с буквами в небе. Сухое стирание движений рук с гласными, диаграммами и приклеенными звуками (семейства слов). Основы для непрерывной грамотности. Эти рабочие листы с дробями на числовой линии помогают детям визуально понимать дроби. Добавление дробей. Сложите подобные, непохожие, правильные, неправильные и смешанные фракции. Включены специальные фракции, такие как единичные и обратные дроби.Вычитание дробей. Рабочие листы бесплатного вычитания включают все типы построения дробей с различными уровнями навыков. 15 августа 2018 г. · Эти бесплатные рабочие листы для детского сада в формате PDF созданы таким образом, чтобы вы могли выбирать различные виды упражнений для ваших нужд. Этот сборник рабочих листов для детского сада охватывает такие важные темы, как почерк и орфография.

    Рабочий лист для юных учащихся. Ученики смотрят картинки и отвечают на вопросы. Воспользуйтесь нашими бесплатными учебными ресурсами, независимо от того, преподаете ли вы английский как второй язык (TESL) или иностранный…Fundations® предлагает обширные программные материалы, позволяющие учителям K-3 уверенно представлять тщательно структурированный учебный план по фонетике и правописанию, используя увлекательные мультисенсорные техники. Каждый уровень финансирования предлагает комплект для учителя, который содержит подробное руководство с ежедневными планами обучения и обширные вспомогательные материалы для … Бесплатные распечатываемые рабочие листы точки зрения в формате PDF для 3, 4, 5, 6, 7, и 8-х классах, которые помогают учащимся создавать свои истории с их точки зрения, что помогает им закрепить свои идеи.Рабочие листы «Точка зрения» доступны для учеников с 3 по 8 классы. Фонды. Рабочие листы для отслеживания. Учебные ресурсы. Рабочие листы по фондам. Рабочий лист представляет собой набор из 4 интригующих занятий … Эти письменные рабочие листы для детского сада помогают развивать мелкую моторику, необходимую для письма, и помогают детям усвоить форму, которую образуют буквы. Некоторые из рабочих листов для этой концепции: Работа с числами, Работа с сеткой письма Уилсона, Работа с письмом, Детский сад.Письменная бумага Smart Start K-1, 100 листов — TCR76501… (Дора Джордан) Выберите рабочий лист Letter S. Настройте свой рабочий лист, изменив шрифт и текст. Потренируйтесь писать букву S в верхнем и нижнем регистре. Учить алфавит весело! Бери мелки и давай раскрашивать! Бесплатные распечатываемые рабочие листы с открытым и закрытым слогом — бесплатные рабочие листы с открытым и закрытым слогом для печати, бесплатные рабочие листы с открытым и закрытым слогом для печати, бесплатные шаблоны для печати в наши дни часто востребованы всеми.Существует множество выпусков, которые публикуются и бесплатно распространяются в Интернете, в том числе в распечатанных.

    17 ноября 2012 г. · Wilson Fundations для K-3 — это программа по изучению фонологии, фонетики и правописания для общеобразовательных классов. Fundations основан на принципах Wilson Reading System® и служит профилактической программой, помогающей уменьшить количество ошибок при чтении и правописании. Префиксы рабочих листов Префиксы рабочих листов, определение префиксов Рабочие листы Общие основные государственные стандарты: 2.L.4.b Определять значение нового слова, образованного при добавлении известного префикса к известному слову; 2. RFS.3.d Расшифровать слова с общими префиксами и суффиксами. Финансирование ЯВНО, потому что не оставляет места для предположений. Он учит всем понятиям напрямую. Уровень 2 — Отображение 8 основных рабочих листов, найденных для этой концепции. Нашли рабочий лист, который вы ищете? Чтобы загрузить / распечатать, щелкните всплывающий значок или значок печати, чтобы распечатать или загрузить.

    25 октября 2012 г. — Блог учителя, в котором есть веселые занятия, советы и множество бесплатных идей, центров и печатных материалов.Дополнительная информация Четыре бесплатных листа для работы с текстом.

    Признаки изношенности шкворня

    31 августа 2018 г. · Изношенный / шквореньный том 1 — результат сотрудничества, рожденного взаимным уважением и дружбой между The Vintage Showroom и Kingpins Show. Красиво сфотографированные предметы из нашего лондонского архива, чередующиеся с запоминающимися уличными снимками Джона Тернера из Стокгольма и Лондона, заигрывают с западной темой и ее влиянием на джинсовую ткань. Ношение тканевой маски напоминает о том, что нельзя прикасаться к лицу, и может еще больше снизить распространение вируса.Перед тем, как выйти из магазина, используйте дезинфицирующее средство для рук. Мойте руки, как только вернетесь домой. 17 апреля 2016 г. · Я предположил, что уплотнение было надето с левой стороны и не выдерживало давления .. Сначала я проверю шкворни, как описано, если все в порядке, то скорее всего проблема с давлением, возможно, отводные диски с этой стороны немного ненадежны, застряли или грязны .. Я никогда не думал проверять движение шкворня, но если он поворачивается в одну сторону, нормально Симптомы — фиолетовые прыщики, вонючие ноги, опухшие глаза , и неконтролируемая отрыжка.Когда он обращается к хорошему, он может вылечить проблемы со здоровьем. Заканчивается (на самом деле в) Ганту, пока он не был спасен в «Снафу» и позже использовал свои силы, чтобы лечить людей, согласно игре на DVD для Lilo & Stitch 2: Stitch Has a Glitch. Сотрудников, у которых поднялась температура (100,4 ° F или выше) или проявляются какие-либо симптомы COVID-19, попросят отправиться домой. Все сотрудники обязаны мыть руки по прибытии в N7 и каждые 20 минут после этого (или после прикосновения к чему-либо, например, посуде, стеклянной посуде, кредитным картам или чему-либо еще, к чему прикасался другой человек).

    «Король» в полноэкранном режиме, лифт включен. Пяточный блок — большое изменение, Kingpin работает без «штифтов», все другие технические крепления на текущем рынке вставляются в пятку вашего ботинка для альпийского (скоростного) режима. Мы поговорили с эпидемиологом UCSF Джорджем Резерфордом, доктором медицины, и специалистом по инфекционным заболеваниям Питером Чином -Хонг, доктор медицины, об отмене CDC в отношении ношения масок, современной науке о том, как работают маски … основные симптомы Обсуждение в ‘6.9L IH & 7.3L IDI Diesel’ началось jtate, 29 февраля 2008 г.29 февраля … У меня были сильно изношенные втулки шкворня на моем D60, я купил …

    Я часто слышу, как клиенты спрашивают о разнице между втулкой и вкладышем. Понятный вопрос. Автомобилисты называют их рукавами, а дизельные — вкладышами. И хотя их можно использовать для схожих целей, восприятие того, что они делают, может сильно отличаться в разных группах. наиболее легкие симптомы и длительный covid: около 10% людей с симптомами сообщают о пост-остром или длительном covid, т.е.e … 20 мая 2018 г. · Изношенные или сломанные рулевые тяги или рулевая рейка: осмотрите компоненты рулевого управления и при необходимости замените. Изношенные шаровые шарниры: осмотрите шаровые шарниры и при необходимости замените. Сломанные крепления рулевой рейки: осмотрите крепления рулевой рейки и отремонтируйте или замените (некоторые автомобили можно отремонтировать, другие требуют замены всей рулевой рейки). Симптомы — жесткие мышцы, скованность в задней части шеи, асфиксия, широко открытые и неподвижные глаза, ristis sardonicus (отведенный в сторону рот) — убедили доктора в том, что детектива Карра отравили стрихнином.У друга Лири Бэррона и босса Лири Макклелланда, безусловно, есть одна общая черта — это Фонд Форда. Баррон получил финансирование от фонда, когда посещал Лири во Флоренции, а Макклелланд — по совпадению также во Флоренции в то время, когда он нанимал Лири, а тот — в стипендию Гуггенхайма — В 1952 и 1953 годах был директором отдела психологических исследований в Фонде Форда. Позвоните по телефону 1-800-437-3609. Agkits.com — это онлайн-источник запчастей для тяжелых двигателей для грузовиков и тракторов.

    9 февраля 2015 г. · Боковина неоднократно изношена. Трещина на нижней стороне. Подшипник слишком далеко от шкива: Горячие подшипники. Вал изгибается. Плохой подшипник или изношен вал: Горячие подшипники. Качающийся шкив. Вал изгибается. Срок службы ремня подошел к концу: нижний край ремня. Ремни совпадают неправильно: ремни чрезмерно вибрируют. Боковина неоднократно изношена. Неправильный тип ремня: пояс заезжает слишком высоко …

    4 января 2019 г. · Организатор наркобизнеса в Аннаполисе в четверг признал себя виновным в том, что возглавил банду, ответственную за распространение героина и фентанила в округе Анн Арундел и штате, несмотря на то, что не верил … Симптомы: до 40% всех инфицированных людей не проявляют никаких симптомов, около 80% проявляют самые легкие симптомы и длительный covid: около 10% людей с симптомами сообщают о пост-острой или длительной covid-инфекции, то есть . . Краткое описание манхва Worn and Torn Newbie: «Я ветеран» Осталось 15 лет до прекращения службы. Я единственный, кто знает, что он такое.

    Мы напоминаем гостям, что если они испытывают какие-либо симптомы простуды или гриппа, даже если они легкие, воздержитесь от посещения нас до полного выздоровления.Чтобы узнать, какие площадки открыты, и узнать о бронировании, щелкните здесь • Изношенные резиновые втулки суппорта • Изношенные направляющие суппорта • Заедание поршня суппорта • Неправильная смазка Больше колодок Меньше выступов колодок Износные выступы на верхних или нижних краях колодок. Травы на поверхности Часто вызваны: • Неправильным размещением колодок. Часто причиной: в корпусе суппорта • • Изношенными ненаправленными компонентами оборудования 22 ноября 1993 г. • Новая информация — читатель указал мне, что копейки, выпущенные до 1965 г., составляют 90% серебро.С 1965 года они изготавливались из сплава меди и никеля. Старые серебряные монеты изнашиваются намного быстрее, чем новые. Десять центов, использованных до туалета, было бы серебром. Все в стране чудес было изношено, от незакрепленных досок в лачугах до запачканных брезентов и палаток, выстроившихся вдоль улиц. Свидетельство того, что когда-то было чистым, но теперь испорчено. Это почти походило на цирк, если у цирка был тайный злой близнец, живущий в аду. Определение того, находится ли неисправный ступичный подшипник со стороны пассажира или водителя транспортного средства.Сделайте пожертвование на мой канал — спасибо! https: //paypal.me/BackYardMech? lo … Сильный стук — ритмичный стук: изношены подшипники коленчатого вала или шатуна. Неплотный гидротрансформатор коробки передач Clunk — случайный стук: ослаблен амортизатор или другой компонент подвески. Ослабленная выхлопная труба или глушитель. Скрип дверных петель сарая — Втулки шкворня из нейлона Morgan (Devol) просрочены для смазки. Есть две причины, по которым коронавирус поставил Италию на колени. Во-первых, это разрушительный грипп, когда люди действительно болеют, им нужны недели интенсивной терапии, а во-вторых, из-за того, насколько быстро и эффективно он распространяется.

    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *